Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-pdat

Saccharomyces cerevisiae (Baker's yeast) phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (pdat) LRO1

Comment
Other strains: Saccharomyces cerevisiae (strain AWRI1631; VIN 13; YJM789; Zymaflore VL3; FostersB; RM11-1a; JAY291; Lalvin EC1118 / Prise de mousse; ATCC 204508 / S288c)


Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : X77395, Z71623
>3 UniProt links 3 more: P40345, B5VR39, A6ZS82
>3 UniProt links 3 more: P40345, B5VR39, A6ZS82
>3 Interpro links 3 more: P40345, B5VR39, A6ZS82
>3 Prodom links 3 more: P40345, B5VR39, A6ZS82
>3 Pfam links 3 more: P40345, B5VR39, A6ZS82
>3 PIRSF links 3 more: P40345, B5VR39, A6ZS82
>3 SUPERFAM links 3 more: P40345, B5VR39, A6ZS82
1 SGD : S0005291
Sequence
Graphical view for this peptide sequence: yeast-pdat
Colored MSA for PC-sterol_acyltransferase (raw)
MGTLFRRNVQNQKSDSDENNKGGSVHNKRESRNHIHHQQGLGHKRRRGIS
GSAKRNERGKDFDRKRDGNGRKRWRDSRRLIFILGAFLGVLLPFSFGAYH
VHNSDSDLFDNFVNFDSLKVYLDDWKDVLPQGISSFIDDIQAGNYSTSSL
DDLSENFAVGKQLLRDYNIEAKHPVVMVPGVISTGIESWGVIGDDECDSS
AHFRKRLWGSFYMLRTMVMDKVCWLKHVMLDPETGLDPPNFTLRAAQGFE
STDYFIAGYWIWNKVFQNLGVIGYEPNKMTSAAYDWRLAYLDLERRDRYF
TKLKEQIELFHQLSGEKVCLIGHSMGSQIIFYFMKWVEAEGPLYGNGGRG
WVNEHIDSFINAAGTLLGAPKAVPALISGEMKDTIQLNTLAMYGLEKFFS
RIERVKMLQTWGGIPSMLPKGEEVIWGDMKSSSEDALNNNTDTYGNFIRF
ERNTSDAFNKNLTMKDAINMTLSISPEWLQRRVHEQYSFGYSKNEEELRK
NELHHKHWSNPMEVPLPEAPHMKIYCIYGVNNPTERAYVYKEEDDSSALN
LTIDYESKQPVFLTEGDGTVPLVAHSMCHKWAQGASPYNPAGINVTIVEM
KHQPDRFDIRGGAKSAEHVDILGSAELNDYILKIASGNGDLVEPRQLSNL
SQWVSQMPFPM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGTLFRRNVQNQKSDSDENNKGGSVHNKRESRNHIHHQQGLGHKRRRGIS
GSAKRNERGKDFDRKRDGNGRKRWRDSRRLIFILGAFLGVLLPFSFGAYH
VHNSDSDLFDNFVNFDSLKVYLDDWKDVLPQGISSFIDDIQAGNYSTSSL
DDLSENFAVGKQLLRDYNIEAKHPVVMVPGVISTGIESWGVIGDDECDSS
AHFRKRLWGSFYMLRTMVMDKVCWLKHVMLDPETGLDPPNFTLRAAQGFE
STDYFIAGYWIWNKVFQNLGVIGYEPNKMTSAAYDWRLAYLDLERRDRYF
TKLKEQIELFHQLSGEKVCLIGHSMGSQIIFYFMKWVEAEGPLYGNGGRG
WVNEHIDSFINAAGTLLGAPKAVPALISGEMKDTIQLNTLAMYGLEKFFS
RIERVKMLQTWGGIPSMLPKGEEVIWGDMKSSSEDALNNNTDTYGNFIRF
ERNTSDAFNKNLTMKDAINMTLSISPEWLQRRVHEQYSFGYSKNEEELRK
NELHHKHWSNPMEVPLPEAPHMKIYCIYGVNNPTERAYVYKEEDDSSALN
LTIDYESKQPVFLTEGDGTVPLVAHSMCHKWAQGASPYNPAGINVTIVEM
KHQPDRFDIRGGAKSAEHVDILGSAELNDYILKIASGNGDLVEPRQLSNL
SQWVSQMPFPM


References
8 more
    Title: The topology of the triacylglycerol synthesizing enzyme Lro1 indicates that neutral lipids can be produced within the luminal compartment of the endoplasmatic reticulum: Implications for the biogenesis of lipid droplets
    Choudhary V, Jacquier N, Schneiter R
    Ref: Commun Integr Biol, 4:781, 2011 : PubMed

            

    Title: Phospholipid:diacylglycerol acyltransferase: an enzyme that catalyzes the acyl-CoA-independent formation of triacylglycerol in yeast and plants
    Dahlqvist A, Stahl U, Lenman M, Banas A, Lee M, Sandager L, Ronne H, Stymne S
    Ref: Proc Natl Acad Sci U S A, 97:6487, 2000 : PubMed

            

    Title: A lecithin cholesterol acyltransferase-like gene mediates diacylglycerol esterification in yeast
    Oelkers P, Tinkelenberg A, Erdeniz N, Cromley D, Billheimer JT, Sturley SL
    Ref: Journal of Biological Chemistry, 275:15609, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer