Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ppme1

Saccharomyces cerevisiae (Baker's yeast) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1) (yms2)

Comment
Other strains: Saccharomyces cerevisiae (strain VIN 13; AWRI1631; RM11-1a; YJM789; Lalvin QA23; FostersO; Lalvin EC1118 / Prise de mousse; FostersB; Zymaflore VL3; AWRI796; JAY291) (Baker's yeast) OldSwissProt YHN5_YEAST PPE1_YEAST hypothetical 44.9 kda protein in erg7-nmd2 intergenic region YHN5_YEAST


Relationship
Family|PPase_methylesterase_euk
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U10556, ADXC01000042
>3 UniProt links 3 more: P38796, B5VK04, B3LSJ3
>3 UniProt links 3 more: P38796, B5VK04, B3LSJ3
>3 Interpro links 3 more: P38796, B5VK04, B3LSJ3
>3 Prodom links 3 more: P38796, B5VK04, B3LSJ3
>3 Pfam links 3 more: P38796, B5VK04, B3LSJ3
>3 PIRSF links 3 more: P38796, B5VK04, B3LSJ3
>3 SUPERFAM links 3 more: P38796, B5VK04, B3LSJ3
1 SGD : S0001117
Sequence
Graphical view for this peptide sequence: yeast-ppme1
Colored MSA for PPase_methylesterase_euk (raw)
MSDDLRRKIALSQFERAKNVLDATFQEAYEDDENDGDALGSLPSFNGQSN
RNRKYTGKTGSTTDRISSKEKSSLPTWSDFFDNKELVSLPDRDLDVNTYY
TLPTSLLSNTTSIPIFIFHHGAGSSGLSFANLAKELNTKLEGRCGCFAFD
ARGHAETKFKKADAPICFDRDSFIKDFVSLLNYWFKSKISQEPLQKVSVI
LIGHSLGGSICTFAYPKLSTELQKKILGITMLDIVEEAAIMALNKVEHFL
QNTPNVFESINDAVDWHVQHALSRLRSSAEIAIPALFAPLKSGKVVRITN
LKTFSPFWDTWFTDLSHSFVGLPVSKLLILAGNENLDKELIVGQMQGKYQ
LVVFQDSGHFIQEDSPIKTAITLIDFWKRNDSRNVVIKTNWGQHKTVQNT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDDLRRKIALSQFERAKNVLDATFQEAYEDDENDGDALGSLPSFNGQSN
RNRKYTGKTGSTTDRISSKEKSSLPTWSDFFDNKELVSLPDRDLDVNTYY
TLPTSLLSNTTSIPIFIFHHGAGSSGLSFANLAKELNTKLEGRCGCFAFD
ARGHAETKFKKADAPICFDRDSFIKDFVSLLNYWFKSKISQEPLQKVSVI
LIGHSLGGSICTFAYPKLSTELQKKILGITMLDIVEEAAIMALNKVEHFL
QNTPNVFESINDAVDWHVQHALSRLRSSAEIAIPALFAPLKSGKVVRITN
LKTFSPFWDTWFTDLSHSFVGLPVSKLLILAGNENLDKELIVGQMQGKYQ
LVVFQDSGHFIQEDSPIKTAITLIDFWKRNDSRNVVIKTNWGQHKTVQNT


References
8 more
    Title: Carboxyl methylation of the phosphoprotein phosphatase 2A catalytic subunit promotes its functional association with regulatory subunits in vivo
    Wu J, Tolstykh T, Lee J, Boyd K, Stock JB, Broach JR
    Ref: EMBO Journal, 19:5672, 2000 : PubMed

            

    Title: Identification and characterization of the genes for mitochondrial ribosomal proteins of Saccharomyces cerevisiae
    Kitakawa M, Graack HR, Grohmann L, Goldschmidt-Reisin S, Herfurth E, Wittmann-Liebold B, Nishimura T, Isono K
    Ref: European Journal of Biochemistry, 245:449, 1997 : PubMed

            

    Title: Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII
    Johnston M, Andrews S, Brinkman R, Cooper J, Ding H, Dover J, Du Z, Favello A, Fulton L and et al. <1 more author(s)>
    Ref: Science, 265:2077, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer