Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-yby9

Saccharomyces cerevisiae chromosome II reading frame ORF YBR139w

Comment
Other strains: Saccharomyces cerevisiae (YJM789; EC1118 / Prise de mousse; RM11-1a; Lalvin QA23; FostersB; AWRI796; VIN 13; AWRI1631; JAY291; Kyokai no. 7 / NBRC 101557; VIN7) (Baker's yeast)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : Z36008
>3 UniProt links 5 more: P38109, A6ZL82, D3UEN3
1 Ncbi-nid : 536435
1 Ncbi-pid : 536436
>3 UniProt links 5 more: P38109, A6ZL82, D3UEN3
>3 Interpro links 5 more: P38109, A6ZL82, D3UEN3
>3 Prodom links 5 more: P38109, A6ZL82, D3UEN3
>3 Pfam links 5 more: P38109, A6ZL82, D3UEN3
>3 PIRSF links 5 more: P38109, A6ZL82, D3UEN3
>3 SUPERFAM links 5 more: P38109, A6ZL82, D3UEN3
1 SGD : S0000343
Sequence
Graphical view for this peptide sequence: yeast-yby9
Colored MSA for Carboxypeptidase_S10 (raw)
MKYLNLVFVLQLLISIKYASFGRAFSLFEDDTTFANLDKQLKLPQNTQQT
LKLDRLNHDDPLFTTFISSVDTDYSLRLRTVDPSKLGIDTVKQWSGYMDY
KDSKHFFYWFFESRNDPANDPIILWLNGGPGCSSFTGLLFELGPSSIGAD
MKPIHNPYSWNNNASMIFLEQPLGVGFSYGDEKVSSTKLAGKDAYIFLEL
FFEAFPHLRSNDFHIAGESYAGHYIPQIAHEIVVKNPERTFNLTSVMIGN
GITDPLIQADYYEPMACGKGGYHPVLSSEECEKMSKAAGRCRRLNKLCYA
SKSSLPCIVATAYCDSALLEPYINTGLNVYDIRGPCEDNSTDGMCYTGLR
YVDQYMNFPEVQETLGSDVHNYSGCDNDVFTGFLFTGDGSKPFQQYIAEL
LNHNIPVLIYAGDKDYICNWLGNHAWSNELEWINKRRYQRRMLRPWVSKE
TGEELGQVKNYGPFTFLRIYDAGHMVPYDQPEASLEMVNSWISGNRAFSD
LSTLENAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKYLNLVFVLQLLISIKYASFGRAFSLFEDDTTFANLDKQLKLPQNTQQT
LKLDRLNHDDPLFTTFISSVDTDYSLRLRTVDPSKLGIDTVKQWSGYMDY
KDSKHFFYWFFESRNDPANDPIILWLNGGPGCSSFTGLLFELGPSSIGAD
MKPIHNPYSWNNNASMIFLEQPLGVGFSYGDEKVSSTKLAGKDAYIFLEL
FFEAFPHLRSNDFHIAGESYAGHYIPQIAHEIVVKNPERTFNLTSVMIGN
GITDPLIQADYYEPMACGKGGYHPVLSSEECEKMSKAAGRCRRLNKLCYA
SKSSLPCIVATAYCDSALLEPYINTGLNVYDIRGPCEDNSTDGMCYTGLR
YVDQYMNFPEVQETLGSDVHNYSGCDNDVFTGFLFTGDGSKPFQQYIAEL
LNHNIPVLIYAGDKDYICNWLGNHAWSNELEWINKRRYQRRMLRPWVSKE
TGEELGQVKNYGPFTFLRIYDAGHMVPYDQPEASLEMVNSWISGNRAFSD
LSTLENAS


References
3 more
    Title: Genome sequencing and comparative analysis of Saccharomyces cerevisiae strain YJM789
    Wei W, McCusker JH, Hyman RW, Jones T, Ning Y, Cao Z, Gu Z, Bruno D, Miranda M and Steinmetz LM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:12825, 2007 : PubMed

            

    Title: The sequence of 29.7 kb from the right arm of chromosome II reveals 13 complete open reading frames, of which ten correspond to new genes
    Becam AM, Cullin C, Grzybowska E, Lacroute F, Nasr F, Ozier-Kalogeropoulos O, Palucha A, Slonimski PP, Zagulski M, Herbert CJ
    Ref: Yeast, 10 Suppl A:S1, 1994 : PubMed

            

    Title: Complete DNA sequence of yeast chromosome II
    Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N and Schaaff-Gerstenschlger I <91 more author(s)>
    Ref: EMBO Journal, 13:5795, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer