Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-yfd4

Saccharomyces cerevisiae (Baker's yeast) (strains YJM789; RM11-1a; AWRI1631) Uncharacterized membrane protein Mil1 YFL034W

Comment
The lipase like protein: yeast-yfd4 Mil1(Yfl034w), specifically binds Apm2, one of the adaptor protein of (AP) complexes responsible for binding clathrin, cargo-sorting motifs, accessory factors, and membrane lipids. The paper by Whitfield et al. is the first description of a function for a member of the Duf_726 family. The same protein had been shown to interact with the ribosomal phosphoprotein P0 Aruna et al... yeast-yfd4 has a conserved catalytic triad only central part Pfam A DUF726 536 875


Relationship
Family|Duf_726
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: D50617, AAFW02000176, ABSV01000755
>3 UniProt links 1 more: P43564, A7A206, B5VHZ5
>3 UniProt links 1 more: P43564, A7A206, B5VHZ5
>3 Interpro links 1 more: P43564, A7A206, B5VHZ5
>3 Prodom links 1 more: P43564, A7A206, B5VHZ5
>3 Pfam links 1 more: P43564, A7A206, B5VHZ5
>3 PIRSF links 1 more: P43564, A7A206, B5VHZ5
>3 SUPERFAM links 1 more: P43564, A7A206, B5VHZ5
Sequence
Graphical view for this peptide sequence: yeast-yfd4
Colored MSA for Duf_726 (raw)
MVGGSLVLGLSGGLLAPVIGGGIAAGLSTIGITGATSFLTGVGGTTVVAV
SSTAIGANIGARGMSKRMGSVRTFEFRPLHNNRRVNLILTVSGWMVGNED
DVRLPFSTVDPVEGDLYSLYWEPEMLKSIGQTVSIVATEIFTTSLQQILG
ATVLTALISSIQWPMALSKLGYILDNPWNVSLDRAWSAGKILADTLIARN
LGARPITLVGFSIGARVIFSCLIELCKKKALGLIENVYLFGTPAVMKKEQ
LVMARSVVSGRFVNGYSDKDWFLAYLFRAAAGGFSAVMGISTIENVEGIE
NINCTEFVDGHLNYRKSMPKLLKRIGIAV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVGGSLVLGLSGGLLAPVIGGGIAAGLSTIGITGATSFLTGVGGTTVVAV
SSTAIGANIGARGMSKRMGSVRTFEFRPLHNNRRVNLILTVSGWMVGNED
DVRLPFSTVDPVEGDLYSLYWEPEMLKSIGQTVSIVATEIFTTSLQQILG
ATVLTALISSIQWPMALSKLGYILDNPWNVSLDRAWSAGKILADTLIARN
LGARPITLVGFSIGARVIFSCLIELCKKKALGLIENVYLFGTPAVMKKEQ
LVMARSVVSGRFVNGYSDKDWFLAYLFRAAAGGFSAVMGISTIENVEGIE
NINCTEFVDGHLNYRKSMPKLLKRIGIAV


References
6 more
    Title: Identification of a hypothetical membrane protein interactor of ribosomal phosphoprotein P0
    Aruna K, Chakraborty T, Nambeesan S, Mannan AB, Sehgal A, Bhalchandara SR, Sharma S
    Ref: J Biosci, 29:33, 2004 : PubMed

            

    Title: Global analysis of protein expression in yeast
    Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
    Ref: Nature, 425:737, 2003 : PubMed

            

    Title: Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae
    Murakami Y, Naitou M, Hagiwara H, Shibata T, Ozawa M, Sasanuma S, Sasanuma M, Tsuchiya Y, Soeda E and et al. <1 more author(s)>
    Ref: Nat Genet, 10:261, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer