yeast-yg19

 
Saccharomyces cerevisiae (Baker's yeast) EAT1 YGR015C hypothetical 37.9 kda protein in msb2-uga1 intergenic region

Comment
Other strains: Saccharomyces cerevisiae (strain JAY291; YJM789; FostersO; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; FostersB; AWRI796; Lalvin QA23; Zymaflore VL3; VIN 13) (Baker's yeast)


Relationship
Block X
Saccharomyces cerevisiae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : Z72800, NP_011529
>3 UniProt links 3 more: P53208, C7GK84, A6ZV06
>3 UniProtTrembl links 3 more: P53208, C7GK84, A6ZV06
>3 Interpro links 3 more: P53208, C7GK84, A6ZV06
>3 Prodom links 3 more: P53208, C7GK84, A6ZV06
>3 Pfam links 3 more: P53208, C7GK84, A6ZV06
>3 PIRSF links 3 more: P53208, C7GK84, A6ZV06
>3 SUPERFAM links 3 more: P53208, C7GK84, A6ZV06
>3 QuickSwissBlast links 3 more: P53208, C7GK84, A6ZV06
1 SGD : S0003247
 
Sequence
Graphical view for this peptide sequence: yeast-yg19
Colored MSA for ABHD11-Acetyl_transferase (raw)
MSRLAHNKALPYKIIVDLSFHRTRLPSDVSSLIKFEQRPAIINIHGLLGS
HVMFHSLNKLLSRKLDADIFSVDVRNHGISPKAIPYDYTTLTNDLIYFIE
THIGLERPIYLLGFSMGGKIALLTTLYKNINIRKCISIDLPPYETPELDP
MILQNYDLIMRIIRRDVKILRGSPSWQKKVLELFKSLECNKRKCGGAVAL
YFANGFLSVKSNNVHQAQLHYEQQQHDPYINYSMPLSSMPNLLDEVKKWP
DLSNQRDFFQKGTASRKVLFMKGLQSNFINNDYSLLRYNFPCADVREFNT
GHNLLLENPEDSFKCILNFFAEETLDFE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRLAHNKALPYKIIVDLSFHRTRLPSDVSSLIKFEQRPAIINIHGLLGS
HVMFHSLNKLLSRKLDADIFSVDVRNHGISPKAIPYDYTTLTNDLIYFIE
THIGLERPIYLLGFSMGGKIALLTTLYKNINIRKCISIDLPPYETPELDP
MILQNYDLIMRIIRRDVKILRGSPSWQKKVLELFKSLECNKRKCGGAVAL
YFANGFLSVKSNNVHQAQLHYEQQQHDPYINYSMPLSSMPNLLDEVKKWP
DLSNQRDFFQKGTASRKVLFMKGLQSNFINNDYSLLRYNFPCADVREFNT
GHNLLLENPEDSFKCILNFFAEETLDFE

no DNA




References
2 more
    Title: Genome structure of a Saccharomyces cerevisiae strain widely used in bioethanol production
    Argueso JL, Carazzolle MF, Mieczkowski PA, Duarte FM, Netto OV, Missawa SK, Galzerani F, Costa GG, Vidal RO and Pereira GA <11 more author(s)>
    Ref: Genome Res, 19:2258, 2009 : PubMed

            

    Title: Genome sequencing and comparative analysis of Saccharomyces cerevisiae strain YJM789
    Wei W, McCusker JH, Hyman RW, Jones T, Ning Y, Cao Z, Gu Z, Bruno D, Miranda M and Steinmetz LM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:12825, 2007 : PubMed

            

    Title: Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII
    Rieger M, Bruckner M, Schafer M, Muller-Auer S
    Ref: Yeast, 13:1077, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer