yeast-yg1l

 
Saccharomyces cerevisiae (Baker's yeast) IMO32 hypothetical 38.5 kda protein in erv1-gls2 intergenic region

Relationship
Block X
Saccharomyces cerevisiae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : Z72816, DQ115390
1 UniProt : P53219
1 UniProtTrembl : P53219
1 Interpro : P53219
1 Prodom : P53219
1 Pfam : P53219
1 PIRSF : P53219
1 SUPERFAM : P53219
1 QuickSwissBlast : P53219
1 SGD : S0003263
 
Sequence
Graphical view for this peptide sequence: yeast-yg1l
Colored MSA for ABHD11-Acetyl_transferase (raw)
MMILGKAGILAQYGTIYVRQNTIRNNLSSCIFKQSLCAFHSLAKVLQQKQ
VPLDLSYDIIKRDAVKTGDEGKPRPPIIILHGLFGNKLNNRSIGRNLNKK
LGRDVYLLDLRNHGSSPHSSVHNYEVMSEDVKHFITKHELNTNGGPIIIG
HSMGGKVAMMLVLKNPQLCSMLVCIENAPVSLRPNAEFVEYIKALMEIVN
DKGKTIRTLKQADEHLAERIGGNELVRRFLLTALKKVKMDNSSSVSSYTF
EERIPLATLKDAIVKGEIAAWPLDPARERWTRPALFIRATQSHYVVDEYL
PIIGAFFPRFETRDIDAGHWVNAEKPGECAESIVDFVERHED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMILGKAGILAQYGTIYVRQNTIRNNLSSCIFKQSLCAFHSLAKVLQQKQ
VPLDLSYDIIKRDAVKTGDEGKPRPPIIILHGLFGNKLNNRSIGRNLNKK
LGRDVYLLDLRNHGSSPHSSVHNYEVMSEDVKHFITKHELNTNGGPIIIG
HSMGGKVAMMLVLKNPQLCSMLVCIENAPVSLRPNAEFVEYIKALMEIVN
DKGKTIRTLKQADEHLAERIGGNELVRRFLLTALKKVKMDNSSSVSSYTF
EERIPLATLKDAIVKGEIAAWPLDPARERWTRPALFIRATQSHYVVDEYL
PIIGAFFPRFETRDIDAGHWVNAEKPGECAESIVDFVERHED

no DNA




Reference
    Title: Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII
    Rieger M, Bruckner M, Schafer M, Muller-Auer S
    Ref: Yeast, 13:1077, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer