Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ym60

Saccharomyces cerevisiae (Baker's yeast) monoacylglycerol lipase YMR210W 51.4 kda protein YM8261.04 in rar1-scj1 intergenic region

Comment
Other strains: Saccharomyces cerevisiae (strain Zymaflore VL3; VIN 13; FostersO; JAY291; RM11-1a; FostersB; Lalvin QA23; YJM789; AWRI1631; ATCC 204508 / S288c; Lalvin EC1118 / Prise de mousse) (Baker's yeast)


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: CAA89925, DAA10109, NP_013937
>3 UniProt links 3 more: Q03649, C7GRE1, B3LM98
>3 UniProt links 3 more: Q03649, C7GRE1, B3LM98
>3 Interpro links 3 more: Q03649, C7GRE1, B3LM98
>3 Prodom links 3 more: Q03649, C7GRE1, B3LM98
>3 Pfam links 3 more: Q03649, C7GRE1, B3LM98
>3 PIRSF links 3 more: Q03649, C7GRE1, B3LM98
>3 SUPERFAM links 3 more: Q03649, C7GRE1, B3LM98
1 SGD : S0004823
Sequence
Graphical view for this peptide sequence: yeast-ym60
Colored MSA for abh_upf0017 (raw)
MRLKELLPNFLIVHQEVPEDPIAFKSTDKRENENKEITIPELIDTKVPEL
ADGATDTLYGLLVNGHLQTAYGSFRHFDNIYKVQYKRMIIKYPHGGEGTV
DFAVNGRSTKRRKVEKEYVPTSQPVFNGNLKRRYSYYSPDDPKLNSDDAK
PMLIILHGLTGGSRESYVRAIVHEITTKYDFEACVFNARGCCYSAITTPL
LYNGGWTNDIRYCVNDLRKRFPNRKFYMMGFSLGASIMTNYLGEESDRTK
IECAISVSNPFDLYNSAYFINSTPMGSRFYSPALGHNLLRMVRNHLSTLE
ENPDFKDVIEKHLKKIRTVRQFDNLLTGPMFGYKNAEEYYKNASSYKRIP
GIRTPFIALHAQDDPIVGGDLPIDQIKSNPYTLLLETSTGGHVGWFKDRS
GRRWYAEPLCRFLKIFHDEITVKGLKPDLENVQLPDPNCEPIATTFRAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLKELLPNFLIVHQEVPEDPIAFKSTDKRENENKEITIPELIDTKVPEL
ADGATDTLYGLLVNGHLQTAYGSFRHFDNIYKVQYKRMIIKYPHGGEGTV
DFAVNGRSTKRRKVEKEYVPTSQPVFNGNLKRRYSYYSPDDPKLNSDDAK
PMLIILHGLTGGSRESYVRAIVHEITTKYDFEACVFNARGCCYSAITTPL
LYNGGWTNDIRYCVNDLRKRFPNRKFYMMGFSLGASIMTNYLGEESDRTK
IECAISVSNPFDLYNSAYFINSTPMGSRFYSPALGHNLLRMVRNHLSTLE
ENPDFKDVIEKHLKKIRTVRQFDNLLTGPMFGYKNAEEYYKNASSYKRIP
GIRTPFIALHAQDDPIVGGDLPIDQIKSNPYTLLLETSTGGHVGWFKDRS
GRRWYAEPLCRFLKIFHDEITVKGLKPDLENVQLPDPNCEPIATTFRAN


References
5 more
    Title: Ymr210wp leads to the accumulation of phospholipids and steryl esters in yeast
    Manda NK, Thunuguntla VBSC, Bokka CS, Singh BJ
    Ref: Bioinformation, 13:360, 2017 : PubMed

            

    Title: MGL2/YMR210w encodes a monoacylglycerol lipase in Saccharomyces cerevisiae
    Selvaraju K, Gowsalya R, Vijayakumar R, Nachiappan V
    Ref: FEBS Letters, 590:1174, 2016 : PubMed

            

    Title: The Saccharomyces cerevisiae EHT1 and EEB1 genes encode novel enzymes with medium-chain fatty acid ethyl ester synthesis and hydrolysis capacity
    Saerens SM, Verstrepen KJ, Van Laere SD, Voet AR, Van Dijck P, Delvaux FR, Thevelein JM
    Ref: Journal of Biological Chemistry, 281:4446, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer