Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ynl5

Saccharomyces cerevisiae (Baker's yeast) YNL115C hypothetical 74.0 kda protein in mls1-rpc19 intergenic region

Comment
Only c-term Pfam Abhydrolase_1 348 622, n-term DUF2417. Other strains: Saccharomyces cerevisiae (strains YJM789; VIN 13; AWRI796; AWRI1631; RM11-1a; JAY291; FostersB; FostersO; Lalvin EC1118 / Prise de mousse) (Baker's yeast)


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: Z69382, Z71391, AAFW02000067
>3 UniProt links 3 more: P53925, A6ZRW8, B5VQT1
>3 UniProt links 3 more: P53925, A6ZRW8, B5VQT1
>3 Interpro links 3 more: P53925, A6ZRW8, B5VQT1
>3 Prodom links 3 more: P53925, A6ZRW8, B5VQT1
>3 Pfam links 3 more: P53925, A6ZRW8, B5VQT1
>3 PIRSF links 3 more: P53925, A6ZRW8, B5VQT1
>3 SUPERFAM links 3 more: P53925, A6ZRW8, B5VQT1
1 SGD : S0005059
Sequence
Graphical view for this peptide sequence: yeast-ynl5
Colored MSA for 6_AlphaBeta_hydrolase (raw)
ITVQSPSYEAFHYVDAAKTYQLHITCYGDVFDQENNTDLSENKKQPIILF
EHGGYDTGYLSATWIEELYHLDKIQRYCLYDRPGYGLSDSPPAPISIAMV
AESLRYALIKDAKIKGPFTTVGYDLGGLFTRVFTAKNVDIVDSMMLVESW
HEELLLKNYIQRLLPPGRGDGDDGDDGNGNDGDGRNHDKTWLPSEIERHN
EFRLWWKGIWSSLGWRLQTSWLLAHHGSKERIYGRDMKYQGRFLRSKFLE
SVTSSILSYRDVTNNAESLQNVKTSIVSSKEMVKKSALWGDWQRDLTKIS
HKTQEWKIVEGGHEIYKYGLGKQQTQEVLLRLIGELGKLTED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ITVQSPSYEAFHYVDAAKTYQLHITCYGDVFDQENNTDLSENKKQPIILF
EHGGYDTGYLSATWIEELYHLDKIQRYCLYDRPGYGLSDSPPAPISIAMV
AESLRYALIKDAKIKGPFTTVGYDLGGLFTRVFTAKNVDIVDSMMLVESW
HEELLLKNYIQRLLPPGRGDGDDGDDGNGNDGDGRNHDKTWLPSEIERHN
EFRLWWKGIWSSLGWRLQTSWLLAHHGSKERIYGRDMKYQGRFLRSKFLE
SVTSSILSYRDVTNNAESLQNVKTSIVSSKEMVKKSALWGDWQRDLTKIS
HKTQEWKIVEGGHEIYKYGLGKQQTQEVLLRLIGELGKLTED


References
3 more
    Title: Sequential elimination of major-effect contributors identifies additional quantitative trait loci conditioning high-temperature growth in yeast
    Sinha H, David L, Pascon RC, Clauder-Munster S, Krishnakumar S, Nguyen M, Shi G, Dean J, Davis RW and Steinmetz LM <2 more author(s)>
    Ref: Genetics, 180:1661, 2008 : PubMed

            

    Title: Genome sequencing and comparative analysis of Saccharomyces cerevisiae strain YJM789
    Wei W, McCusker JH, Hyman RW, Jones T, Ning Y, Cao Z, Gu Z, Bruno D, Miranda M and Steinmetz LM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:12825, 2007 : PubMed

            

    Title: The DNA sequence of cosmid 14-13b from chromosome XIV of Saccharomyces cerevisiae reveals an unusually high number of overlapping open reading frames
    De Antoni A, D'Angelo M, Dal Pero F, Sartorello F, Pandolfo D, Pallavicini A, Lanfranchi G, Valle G
    Ref: Yeast, 13:261, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer