Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-yo059

Saccharomyces cerevisiae (Baker's yeast) Putative lipase YOR059C LPL1 chromosome xv orf yor059c YOR29-10

Comment
Other strains: Saccharomyces cerevisiae (strain YJM789; RM11-1a; Lalvin QA23; JAY291; FostersO; FostersB; Lalvin EC1118 / Prise de mousse; AWRI796; VIN 13; AWRI1631


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : Z74967, Z70678
>3 UniProt links 3 more: Q08448, A6ZNR1, B3LJA8
>3 UniProt links 3 more: Q08448, A6ZNR1, B3LJA8
>3 Interpro links 3 more: Q08448, A6ZNR1, B3LJA8
>3 Prodom links 3 more: Q08448, A6ZNR1, B3LJA8
>3 Pfam links 3 more: Q08448, A6ZNR1, B3LJA8
>3 PIRSF links 3 more: Q08448, A6ZNR1, B3LJA8
>3 SUPERFAM links 3 more: Q08448, A6ZNR1, B3LJA8
Sequence
Graphical view for this peptide sequence: yeast-yo059
Colored MSA for Duf_676 (raw)
MTSDKHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNA
MFKTFDGIEIIGYRTLIEVCEFIRDYKDGKITKLSVMGYSQGGLVARFMI
GKMLTEFKELFEDIEPQLFITMATPHLGVEFYNPTGIAYKSALYSALRTL
GSTILGKSGREMFIANSSNNILVKLSQGEYLEALSLFKWRIAFANVKNDR
TVAFYTAFITDCDPFIDFDNKLKYTFEEKIPGSGYKGILPKIVDLNALNV
NSHAPTKPTKTYKKWGRTILIILVATFLILPIALVMNGLGTAYSYIVTCK
YRKMLSNGILHNEVRGKLGLTEQLKGYVTDAYGSIINSALDMDANYEASN
SNLVNEEELPWKEFIQKYTTINDGVWKSKFKKLPFDENRKVILRNLNKLK
WIRVPIYIKAVNAHGVIVARRGMDENTAATGIACIEFTAQLLAYLMHKSN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSDKHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNA
MFKTFDGIEIIGYRTLIEVCEFIRDYKDGKITKLSVMGYSQGGLVARFMI
GKMLTEFKELFEDIEPQLFITMATPHLGVEFYNPTGIAYKSALYSALRTL
GSTILGKSGREMFIANSSNNILVKLSQGEYLEALSLFKWRIAFANVKNDR
TVAFYTAFITDCDPFIDFDNKLKYTFEEKIPGSGYKGILPKIVDLNALNV
NSHAPTKPTKTYKKWGRTILIILVATFLILPIALVMNGLGTAYSYIVTCK
YRKMLSNGILHNEVRGKLGLTEQLKGYVTDAYGSIINSALDMDANYEASN
SNLVNEEELPWKEFIQKYTTINDGVWKSKFKKLPFDENRKVILRNLNKLK
WIRVPIYIKAVNAHGVIVARRGMDENTAATGIACIEFTAQLLAYLMHKSN


References
6 more
    Title: Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae
    Athenstaedt K, Zweytick D, Jandrositz A, Kohlwein SD, Daum G
    Ref: Journal of Bacteriology, 181:6441, 1999 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XV
    Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M and Kleine K <87 more author(s)>
    Ref: Nature, 387:98, 1997 : PubMed

            

    Title: The sequence of a 54.7 kb fragment of yeast chromosome XV reveals the presence of two tRNAs and 24 new open reading frames
    Valens M, Bohn C, Daignan-Fornier B, Dang VD, Bolotin-Fukuhara M
    Ref: Yeast, 13:379, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer