Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeasv-e7ltm5

Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). YEL023C-like protein

Comment
only n-term Pfam A DUF2235 32 417


Relationship
Family|Duf_2235
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ADXC01000028
Sequence
Graphical view for this peptide sequence: yeasv-e7ltm5
Colored MSA for Duf_2235 (raw)
MDSFNYIHGKYKKNGTGGDRSINPSSHSSSGKNIILCFDGTRENFGPQPF
TNILKLYNLLENGDSSEQICYYQPGIGSVGFDAVVDVRRRLTISHLQNLL
DSMFAFSLDNHICSAYLFLMKYFEPGDRIYMFGFSRGAFIARVLAGMIER
VGLLSKGLEEMVKMAWQIYEKWEYDSQPNELQYTSTLAEEFKKTFSRDYE
VKIHFQGLFDSVNSVGILRDRLFPCTQRSNIVEHVRHCVSLDERRGKFKQ
LCFTPMPYIPKLFSLTYCNHITDQCSPVPTSNALMRDLTPENPLIKYTLK
SGAHSISNPSPLIPDNPGRLLSSKSEETTELLLDLNSFLEGNSYARDTEC
STRGIEAIFQLQSIQGSGTSSRMTMTPDLIEKWFPGDHSDVGGGWAPDCE
TEENLSNLTLRWILAEAIKFGVKFKPG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDSFNYIHGKYKKNGTGGDRSINPSSHSSSGKNIILCFDGTRENFGPQPF
TNILKLYNLLENGDSSEQICYYQPGIGSVGFDAVVDVRRRLTISHLQNLL
DSMFAFSLDNHICSAYLFLMKYFEPGDRIYMFGFSRGAFIARVLAGMIER
VGLLSKGLEEMVKMAWQIYEKWEYDSQPNELQYTSTLAEEFKKTFSRDYE
VKIHFQGLFDSVNSVGILRDRLFPCTQRSNIVEHVRHCVSLDERRGKFKQ
LCFTPMPYIPKLFSLTYCNHITDQCSPVPTSNALMRDLTPENPLIKYTLK
SGAHSISNPSPLIPDNPGRLLSSKSEETTELLLDLNSFLEGNSYARDTEC
STRGIEAIFQLQSIQGSGTSSRMTMTPDLIEKWFPGDHSDVGGGWAPDCE
TEENLSNLTLRWILAEAIKFGVKFKPG


Reference
    Title: Whole-genome comparison reveals novel genetic elements that characterize the genome of industrial strains of Saccharomyces cerevisiae
    Borneman AR, Desany BA, Riches D, Affourtit JP, Forgan AH, Pretorius IS, Egholm M, Chambers PJ
    Ref: PLoS Genet, 7:e1001287, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer