Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yerpe-YBTT

Yersinia pestis, Escherichia coli, Yersinia pseudotuberculosis ybtt (yersiniabactin biosynthetic protein ybtt)

Comment
Other strains: Escherichia coli (strains O6; UTI89/UPEC; E110019;MS 198-1; MS 185-1; MS 21-1; MS 175-1; MS 200-1; FVEC1302; MS 45-1; MS 196-1; 83972; 53638; F11; NC101; O45:K1/S88/ExPEC; O44:H18/042/EAEC; O18:K1:H7/IHE3034/ExPEC; O7:K1/IAI39/ExPEC; O1:K1/APEC; O81/ED1a; O26:H11/11368/EHEC; O17:K52:H18/UMN026/ExPEC; 55989; O6:K15:H31/536/UPEC; MS 84-1; MS 45-1; MS 182-1; 3_2_53FAA; O150:H5/SE15)


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 6BA8, 6BA9
No kinetic





No Substrate
No inhibitor
>3 Genbank links 32 more: U50364, AE013845, AL031866
>3 UniProt links 14 more: Q7BS79, Q3V7P8, A0A061LQM0
2 Structure : 6BA8, 6BA9
>3 UniProt links 11 more: A0A061LQM0, Q56949, Q8D0C3
>3 Interpro links 11 more: A0A061LQM0, Q56949, Q8D0C3
>3 Pfam links 11 more: A0A061LQM0, Q56949, Q8D0C3
>3 PIRSF links 11 more: A0A061LQM0, Q56949, Q8D0C3
>3 SUPERFAM links 11 more: A0A061LQM0, Q56949, Q8D0C3
Sequence
Graphical view for this peptide sequence: yerpe-YBTT
Colored MSA for Thioesterase (raw)
MTQSAMCIPLWPARNGNTAHLVMCPFAGGSSSAFRHWQAEQLTDCALSLV
TWPGRDRLRHLEPLRSITQLAALLANELEASVSPDTPLLLAGHSMGAQVA
FETCRLLEQRGLAPQGLIISGCHAPHLHSERQLSHRDDADFIAELIDIGG
CSPELRENQELMSLFLPLLRADFYATESYHYDSPDVCPPLRTPALLLCGS
HDREASWQQVDAWRQWLSHVTGPVVIDGDHFYPIQQARSFFTQIVRHFPH
AFSAMTALQKQPSTSER
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTQSAMCIPLWPARNGNTAHLVMCPFAGGSSSAFRHWQAEQLTDCALSLV
TWPGRDRLRHLEPLRSITQLAALLANELEASVSPDTPLLLAGHSMGAQVA
FETCRLLEQRGLAPQGLIISGCHAPHLHSERQLSHRDDADFIAELIDIGG
CSPELRENQELMSLFLPLLRADFYATESYHYDSPDVCPPLRTPALLLCGS
HDREASWQQVDAWRQWLSHVTGPVVIDGDHFYPIQQARSFFTQIVRHFPH
AFSAMTALQKQPSTSER


References
11 more
    Title: YbtT is a low-specificity type II thioesterase that maintains production of the metallophore yersiniabactin in pathogenic enterobacteria
    Ohlemacher SI, Xu Y, Kober DL, Malik M, Nix JC, Brett TJ, Henderson JP
    Ref: Journal of Biological Chemistry, 293:19572, 2018 : PubMed

            

    Title: Genome sequence of Yersinia pestis, the causative agent of plague.
    Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MTG, Prentice MB, Sebaihia M, James KD, Churcher C and Barrell BG <25 more author(s)>
    Ref: Nature, 413:523, 2001 : PubMed

            

    Title: Iron acquisition in plague: modular logic in enzymatic biogenesis of yersiniabactin by Yersinia pestis
    Gehring AM, DeMoll E, Fetherston JD, Mori I, Mayhew GF, Blattner FR, Walsh CT, Perry RD
    Ref: Chemical Biology, 5:573, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer