(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Enterobacterales: NE > Yersiniaceae: NE > Yersinia: NE > Yersinia pseudotuberculosis complex: NE > Yersinia pestis: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Yersinia pestis Antiqua: N, E.
Yersinia pestis Pestoides F: N, E.
Yersinia pestis Angola: N, E.
Yersinia pestis Nepal516: N, E.
Yersinia pestis biovar Antiqua str. B42003004: N, E.
Yersinia pestis biovar Orientalis str. MG05-1020: N, E.
Yersinia pestis biovar Mediaevalis str. K1973002: N, E.
Yersinia pestis D106004: N, E.
Yersinia pestis Pestoides A: N, E.
Yersinia pestis D182038: N, E.
Yersinia pestis biovar Orientalis str. IP275: N, E.
Yersinia pestis KIM D27: N, E.
Yersinia pestis biovar Orientalis str. F1991016: N, E.
Yersinia pestis biovar Orientalis str. PEXU2: N, E.
Yersinia pestis biovar Orientalis str. India 195: N, E.
Yersinia pestis biovar Antiqua str. UG05-0454: N, E.
Yersinia pestis biovar Antiqua str. E1979001: N, E.
Yersinia pestis CA88-4125: N, E.
Yersinia pestis biovar Medievalis str. Harbin 35: N, E.
Yersinia pestis Z176003: N, E.
Yersinia pestis biovar Microtus str. 91001: N, E.
Yersinia pestis biovar Medievalis str. 91001: N, E.
Yersinia pestis A1122: N, E.
Yersinia pestis PY-100: N, E.
Yersinia pestis PY-96: N, E.
Yersinia pestis 24H: N, E.
Yersinia pestis PY-52: N, E.
Yersinia pestis PY-99: N, E.
Yersinia pestis PY-66: N, E.
Yersinia pestis PY-13: N, E.
Yersinia pestis PY-47: N, E.
Yersinia pestis PY-04: N, E.
Yersinia pestis EV NIIEG: N, E.
Yersinia pestis PY-09: N, E.
Yersinia pestis PY-19: N, E.
Yersinia pestis PY-46: N, E.
Yersinia pestis PY-12: N, E.
Yersinia pestis PY-71: N, E.
Yersinia pestis PY-90: N, E.
Yersinia pestis PY-06: N, E.
Yersinia pestis 9: N, E.
Yersinia pestis PY-89: N, E.
Yersinia pestis S3: N, E.
Yersinia pestis PY-58: N, E.
Yersinia pestis PY-55: N, E.
Yersinia pestis PY-15: N, E.
Yersinia pestis PY-36: N, E.
Yersinia pestis PY-60: N, E.
Yersinia pestis PY-103: N, E.
Yersinia pestis PY-56: N, E.
Yersinia pestis PY-64: N, E.
Yersinia pestis PY-92: N, E.
Yersinia pestis PY-93: N, E.
Yersinia pestis PY-53: N, E.
Yersinia pestis PY-54: N, E.
Yersinia pestis PY-16: N, E.
Yersinia pestis PY-95: N, E.
Yersinia pestis PY-48: N, E.
Yersinia pestis PY-34: N, E.
Yersinia pestis PY-59: N, E.
Yersinia pestis PY-113: N, E.
Yersinia pestis PY-102: N, E.
Yersinia pestis PY-65: N, E.
Yersinia pestis PY-11: N, E.
Yersinia pestis 113: N, E.
Yersinia pestis PY-08: N, E.
Yersinia pestis PY-25: N, E.
Yersinia pestis PY-14: N, E.
Yersinia pestis PY-01: N, E.
Yersinia pestis PY-29: N, E.
Yersinia pestis PY-61: N, E.
Yersinia pestis PY-76: N, E.
Yersinia pestis PY-03: N, E.
Yersinia pestis PY-91: N, E.
Yersinia pestis PY-07: N, E.
Yersinia pestis PY-02: N, E.
Yersinia pestis PY-88: N, E.
Yersinia pestis PY-63: N, E.
Yersinia pestis PY-72: N, E.
Yersinia pestis PY-10: N, E.
Yersinia pestis PY-05: N, E.
Yersinia pestis PY-45: N, E.
Yersinia pestis INS: N, E.
Yersinia pestis PY-32: N, E.
Yersinia pestis PY-42: N, E.
Yersinia pestis PY-94: N, E.
Yersinia pestis PY-98: N, E.
Yersinia pestis PY-101: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MPAIAIKRWIKRIVLVLVVISITILAIRIYDTQRGPKLELWHTFVPHEMR AAEIDKASWADYIKTENNIFDEVRINVTEKLEPSTQVPLNRYYSGSAIYP PHFKNDWNRSYILQPEGEPKGAVVLLHGLTDTPYSLRHIAENYRQRGYVA IGIRLPAHGSVPAALTDVEWQDWLAATRLAVREAKALSGPDLPLHVVGFS NGGALAMKYTLDSMDDPKLAKPARVILISPMIGVTSFARFAGIAGWPAIF PAFAKAAWLGIVPEFNPFKYNSFPVNAARQSYLLTSVLQQHIARDARNNK MDELPPILTFQSLMDSTVSTRAVVTALYNHLPNNGSEVVLFDLNRAASFG PLLRTSSYTALARLLPPGPRNYSTTVITNVSPQSNETLALTTRAGETNET SVPTGLVYPPDIFSLSHVALPFPMSDSLYGRYPDPRDQYGISLGTFAARG ERAVLVVGLDSLMRISSNPFYPYMLQRIDDKIDAPVQ
We present the complete genome sequence of Yersinia pestis KIM, the etiologic agent of bubonic and pneumonic plague. The strain KIM, biovar Mediaevalis, is associated with the second pandemic, including the Black Death. The 4.6-Mb genome encodes 4,198 open reading frames (ORFs). The origin, terminus, and most genes encoding DNA replication proteins are similar to those of Escherichia coli K-12. The KIM genome sequence was compared with that of Y. pestis CO92, biovar Orientalis, revealing homologous sequences but a remarkable amount of genome rearrangement for strains so closely related. The differences appear to result from multiple inversions of genome segments at insertion sequences, in a manner consistent with present knowledge of replication and recombination. There are few differences attributable to horizontal transfer. The KIM and E. coli K-12 genome proteins were also compared, exposing surprising amounts of locally colinear "backbone," or synteny, that is not discernible at the nucleotide level. Nearly 54% of KIM ORFs are significantly similar to K-12 proteins, with conserved housekeeping functions. However, a number of E. coli pathways and transport systems and at least one global regulator were not found, reflecting differences in lifestyle between them. In KIM-specific islands, new genes encode candidate pathogenicity proteins, including iron transport systems, putative adhesins, toxins, and fimbriae.
The Gram-negative bacterium Yersinia pestis is the causative agent of the systemic invasive infectious disease classically referred to as plague, and has been responsible for three human pandemics: the Justinian plague (sixth to eighth centuries), the Black Death (fourteenth to nineteenth centuries) and modern plague (nineteenth century to the present day). The recent identification of strains resistant to multiple drugs and the potential use of Y. pestis as an agent of biological warfare mean that plague still poses a threat to human health. Here we report the complete genome sequence of Y. pestis strain CO92, consisting of a 4.65-megabase (Mb) chromosome and three plasmids of 96.2 kilobases (kb), 70.3 kb and 9.6 kb. The genome is unusually rich in insertion sequences and displays anomalies in GC base-composition bias, indicating frequent intragenomic recombination. Many genes seem to have been acquired from other bacteria and viruses (including adhesins, secretion systems and insecticidal toxins). The genome contains around 150 pseudogenes, many of which are remnants of a redundant enteropathogenic lifestyle. The evidence of ongoing genome fluidity, expansion and decay suggests Y. pestis is a pathogen that has undergone large-scale genetic flux and provides a unique insight into the ways in which new and highly virulent pathogens evolve.
Yersinia enterocolitica esterase YqiA (YE3661) A1JQU0