Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yerpe-q8zey9

Yersinia pestis Yersinia pseudotuberculosis putative esterase (hypothetical)

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AJ627388, AJ414151, AE013832
1 UniProt : Q6EVR3
2 UniProt : Q7CI98, Q6EVR3
2 Interpro : Q7CI98, Q6EVR3
2 Pfam : Q7CI98, Q6EVR3
2 PIRSF : Q7CI98, Q6EVR3
2 SUPERFAM : Q7CI98, Q6EVR3
Sequence
Graphical view for this peptide sequence: yerpe-q8zey9
Colored MSA for Hormone-sensitive_lipase_like (raw)
MNINTVPLATDFANLLAARRLFFGKGAQHETDYGRQRVARWIANVSAPLS
GKIEVTGHVRRFIPEKLRSAEPIFYLHGGGLVYYSTEVFSAFLSTLAHIS
GREIRAFDYPKAPETPMAELVGHLEQQLSTELNHVDAAPCLMGDSVGGLL
TLWFAGSAFSQAFSQIHLLDAAILRWFAEHWFPWCRQQQFDPLASDYAFS
KLPPVVLHTTEYDVLTDEGLAFAALARQAGASLQHHHHPALPHDFCLYAG
KLASSRQAVEQIAAALDIEHKFPCKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNINTVPLATDFANLLAARRLFFGKGAQHETDYGRQRVARWIANVSAPLS
GKIEVTGHVRRFIPEKLRSAEPIFYLHGGGLVYYSTEVFSAFLSTLAHIS
GREIRAFDYPKAPETPMAELVGHLEQQLSTELNHVDAAPCLMGDSVGGLL
TLWFAGSAFSQAFSQIHLLDAAILRWFAEHWFPWCRQQQFDPLASDYAFS
KLPPVVLHTTEYDVLTDEGLAFAALARQAGASLQHHHHPALPHDFCLYAG
KLASSRQAVEQIAAALDIEHKFPCKK


References
2 more
    Title: YAPI, a new Yersinia pseudotuberculosis pathogenicity island
    Collyn F, Billault A, Mullet C, Simonet M, Marceau M
    Ref: Infect Immun, 72:4784, 2004 : PubMed

            

    Title: Yersinia pseudotuberculosis harbors a type IV pilus gene cluster that contributes to pathogenicity
    Collyn F, Lety MA, Nair S, Escuyer V, Ben Younes A, Simonet M, Marceau M
    Ref: Infect Immun, 70:6196, 2002 : PubMed

            

    Title: Genome sequence of Yersinia pestis, the causative agent of plague.
    Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MTG, Prentice MB, Sebaihia M, James KD, Churcher C and Barrell BG <25 more author(s)>
    Ref: Nature, 413:523, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer