Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yerpe-y3224

Yersinia pestis, Yersinia pseudotuberculosis, hypothetical upf0255 protein ypo3224/y0964/yp0709

Comment
Other strains: Yersinia pestis (and strain Pestoides F) and Yersinia pseudotuberculosis(serotype IB (strain PB1/+)) Yersinia pestis bv. Antiqua (strain Antiqua; Angola; Nepal516; E1979001; UG05-0454; B42003004) serotype O:1b (strain IP 31758) serotype O:3 (strain YPIII); bv. Medievalis (strain Harbin 35; K1973002 ); Orientalis (str. MG05-1020; PEXU2; India 195; IP275; F1991016); CA88-4125; D106004; D182038; Z176003; KIM D27; Pestoides A


Relationship
Family|Duf_1100-R
Block| X
Position in NCBI Life Tree|Yersinia pestis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Yersinia: N E > Yersinia pseudotuberculosis complex: N E > Yersinia pestis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: yerpe-y3224
Colored MSA for Duf_1100-R (raw)
MAQANLSEILFKPKFKHPETSTLVRRTHCNHVVNIHSALDGDTANHWYRM
INRLMWTWRGIDPLEIEEVLSRIACSKAEHSNNELLDTVVGYRNGNWIYE
WANQGMMWQQKAMEETDPGSAGQFWLNAANLYSIASYPHLKGDELSEQAE
VLSNRAYEEAAKYLPYTLKELTFPISDGGSLSGFLHMPTVGSAPFPTVLM
CGGLDTLQSDYHRLFRDYLEPKGIAMLTIDLPSVGASSRWKLTQDTSYLH
QQVLQALADVPWVDHQRVSVFGFRFGANVAVRLGYLEPQRVRAVACLGPI
VHHLLCNSDSLRKVPDMYMDVMASRLGMADSTDETLNTEMNRYSLKTQGL
LGRRCQTPMLAGFWENDPFSPKEEAKLICSSSADGKLLAIPSKPLYENFH
RALLQTSEWLEDKMR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAQANLSEILFKPKFKHPETSTLVRRTHCNHVVNIHSALDGDTANHWYRM
INRLMWTWRGIDPLEIEEVLSRIACSKAEHSNNELLDTVVGYRNGNWIYE
WANQGMMWQQKAMEETDPGSAGQFWLNAANLYSIASYPHLKGDELSEQAE
VLSNRAYEEAAKYLPYTLKELTFPISDGGSLSGFLHMPTVGSAPFPTVLM
CGGLDTLQSDYHRLFRDYLEPKGIAMLTIDLPSVGASSRWKLTQDTSYLH
QQVLQALADVPWVDHQRVSVFGFRFGANVAVRLGYLEPQRVRAVACLGPI
VHHLLCNSDSLRKVPDMYMDVMASRLGMADSTDETLNTEMNRYSLKTQGL
LGRRCQTPMLAGFWENDPFSPKEEAKLICSSSADGKLLAIPSKPLYENFH
RALLQTSEWLEDKMR


References
8 more
    Title: Complete genome sequence of Yersinia pestis strain 91001, an isolate avirulent to humans
    Song Y, Tong Z, Wang J, Wang L, Guo Z, Han Y, Zhang J, Pei D, Zhou D and Yang R <16 more author(s)>
    Ref: DNA Research, 11:179, 2004 : PubMed

            

    Title: Genome sequence of Yersinia pestis KIM
    Deng W, Burland V, Plunkett G, 3rd, Boutin A, Mayhew GF, Liss P, Perna NT, Rose DJ, Mau B and Perry RD <11 more author(s)>
    Ref: Journal of Bacteriology, 184:4601, 2002 : PubMed

            

    Title: Genome sequence of Yersinia pestis, the causative agent of plague.
    Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MTG, Prentice MB, Sebaihia M, James KD, Churcher C and Barrell BG <25 more author(s)>
    Ref: Nature, 413:523, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer