Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: zygrc-c5dxn5

Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) ZYRO0F06468p

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Zygosaccharomyces rouxii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Zygosaccharomyces: N E > Zygosaccharomyces rouxii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CU928178
1 UniProt : C5DXN5
1 UniProt : C5DXN5
1 Interpro : C5DXN5
1 Prodom : C5DXN5
1 Pfam : C5DXN5
1 PIRSF : C5DXN5
1 SUPERFAM : C5DXN5
Sequence
Graphical view for this peptide sequence: zygrc-c5dxn5
Colored MSA for DPP4N_Peptidase_S9 (raw)
MSSSHKRKNSHLFLQRKNSSSFNMEDIELDQFPNDMNHIDNARIVVDPPP
SPSTQENGNAANISLRSRGIMGSWKRYRVRLMLFLGILITLLLFLVPFYI
VKSTADLQKNAENRFRTRSFDIDNVLNGDFSYFEKSFHFIQPPPETVKYH
EEDPGLYLSLQEDDNNDYTILAKQLYDSNFAEPLGTNKFEYESKEYVVQK
VKVSYRLDRTIFATDLKAEFRHSSHGLYWIHDVETGQILPISPHPSLLLT
PVSYAHFSPNFNFVYFVHDNDLYIQSLYTKNPARRLTHGGSFNILHGKPD
WIYEEEVLADEKAVWWCPDDSKLIFAKFDDSEVNTYSFPKYINNGNMFPQ
LEEIKYPKPGSFNPKVELYMLDLNSGLIALINAMESAEGNWGEDYILYDA
SWVGPNAFLFKISDRSSQKLIVRIYDTKNNTIKTMYTLDFKKFDGWVEKA
RNVVPVPPMEEKGRPEYGYLDILPDENGFNHIFYFARFSDTKGQQITKGN
WEVRNQGIVGYEYETHSVFFLSNMVGTMAQHLYTVTINSGSPGEIKTLQN
PDKKEDFYEFELSPSCRYALARKLGSSVPVTIAGDLFDVLDADTAKDNNV
IRLTDDNDLQKSLKRYDLPVTSYKSMVLDDGTEVNYVEIKPPFLDSKKKY
PVLVESYAGPGSQSYFTKFNVFFQQAVSSGLHAIVLLVEPRGTGGKGWKF
KSWAKNKIGYWEPRDITEVTRQFITLNHQFVDKERVAIWGWSYGGFAALK
TIEYDAGQTFNYAMAVAPVTNWTYYDSIYTERYMGLPKENIQGYSDRASI
RDFKSFEKIEKLLVIHGTADDNVHIQNSYEFVDHLNSLGIKNYDMHIFPD
SDHTIHFHNAQKVVFTKLYQWLKDAFAGHFKPR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSSHKRKNSHLFLQRKNSSSFNMEDIELDQFPNDMNHIDNARIVVDPPP
SPSTQENGNAANISLRSRGIMGSWKRYRVRLMLFLGILITLLLFLVPFYI
VKSTADLQKNAENRFRTRSFDIDNVLNGDFSYFEKSFHFIQPPPETVKYH
EEDPGLYLSLQEDDNNDYTILAKQLYDSNFAEPLGTNKFEYESKEYVVQK
VKVSYRLDRTIFATDLKAEFRHSSHGLYWIHDVETGQILPISPHPSLLLT
PVSYAHFSPNFNFVYFVHDNDLYIQSLYTKNPARRLTHGGSFNILHGKPD
WIYEEEVLADEKAVWWCPDDSKLIFAKFDDSEVNTYSFPKYINNGNMFPQ
LEEIKYPKPGSFNPKVELYMLDLNSGLIALINAMESAEGNWGEDYILYDA
SWVGPNAFLFKISDRSSQKLIVRIYDTKNNTIKTMYTLDFKKFDGWVEKA
RNVVPVPPMEEKGRPEYGYLDILPDENGFNHIFYFARFSDTKGQQITKGN
WEVRNQGIVGYEYETHSVFFLSNMVGTMAQHLYTVTINSGSPGEIKTLQN
PDKKEDFYEFELSPSCRYALARKLGSSVPVTIAGDLFDVLDADTAKDNNV
IRLTDDNDLQKSLKRYDLPVTSYKSMVLDDGTEVNYVEIKPPFLDSKKKY
PVLVESYAGPGSQSYFTKFNVFFQQAVSSGLHAIVLLVEPRGTGGKGWKF
KSWAKNKIGYWEPRDITEVTRQFITLNHQFVDKERVAIWGWSYGGFAALK
TIEYDAGQTFNYAMAVAPVTNWTYYDSIYTERYMGLPKENIQGYSDRASI
RDFKSFEKIEKLLVIHGTADDNVHIQNSYEFVDHLNSLGIKNYDMHIFPD
SDHTIHFHNAQKVVFTKLYQWLKDAFAGHFKPR


Reference
    Title: Comparative genomics of protoploid Saccharomycetaceae
    Souciet JL, Dujon B, Gaillardin C, Johnston M, Baret PV, Cliften P, Sherman DJ, Weissenbach J, Westhof E and Talla E <44 more author(s)>
    Ref: Genome Res, 19:1696, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer