ESTHER Database

Home
Search
Tools
Families
Biological
data
Basics on AChE
ESTHER definition
What is up?
Acknowledgments
& disclaimer


1st coding mammals

First coding exon -> mammals AChE


                              MREMNLLVTSSLGVLLHLVVLCQADDDSELLVNTKSGKVM  16   torma-acche
                     MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLR       human-acche
                            MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVR       human-buche
                            MAPLFLLLLLLLSPSPTSAHRFAYSAPNRPEVRTTTGSVRGL       chick-acche
                 MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSGPVR       drome-acche
                                       MRNSLLFFIFLPSTILAVDLIHLHDGSPLFG       caeel-acche
                                                                      


RTRIPVLSSHISAFLGIPFAEPPVGNMRFRRPEP-KKPWSGVWNASTYPNNCQQYVDEQFPGFPGSEMWN  85   torma-acche
GIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEP-KQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWN       human-acche
GMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQS-LTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWN       human-buche
LIPAGPSGSTAAAFLGIPFAVPPLGPLRFRPPLPIPTPWTGIRDADSQPFACYQMVDTTFPGFQGSEMWN       chick-acche
GRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVP-AEPWHGVLDATGLSATCVQERYEYFPGFSGEEIWN       drome-acche
EEVLSQTGKPLTRFQGIPFAEPPVGNLRFKKPKP-KQPWRIPLNATTPPNSCIQSEDTYFGDFYGSTMWN       caeel-acche
               * *   **    **  *      *     *      * *        * *   **


PNREMSEDCLYLNIWVPS---------------------------------PRPKSA-TVMLWIYGGGFY  121  torma-acche
PNRELSEDCLYLNVWTPY---------------------------------PRPTSPTPVLVWIYGGGFY       human-acche
PNTDLSEDCLYLNVWIPA---------------------------------PKPKNA-TVLIWIYGGGFQ       human-buche
PNREMSEDCLYLNVWTQK---------------------------------GDPTEP-PVLVWIYGGGFT       chick-acche
PNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGL-PILIWIYGGGFM       drome-acche
ANTKLSEDCLYLNVYVPGKV-------------------------------DPNKKL-AVMVWVYGGGFW       caeel-acche
 *   ****** *                                                 * ***** 


SGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG-------SQEAPGNMGLLDQRMALQWVHDNI  184  torma-acche
SGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPG-------SREAPGNVGLLDQRLALQWVQENV       human-acche
TGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPG-------NPEAPGNMGLFDQQLALQWVQKNI       human-buche
GGSVSLDVYDGRYLAAAEEAVVVSMNYRVGSLGFLALAG-------HRDAPGNVGLWDQRLALQWVRDNA       chick-acche
TGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAE-EAPGNVGLWDQALAIRWLKDNA       drome-acche
SGTATLDVYDGRILTVEENVILVAMNYRVSIFGFLYMNR-------P-EAPGNMGMWDQLLAMKWVHKNI       caeel-acche
 *   *  *                 ***   **               **** *  **  *      * 


QFFGGDPKTVTLFGESAGRASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELRRNLNC  254  torma-acche
AAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGC       human-acche
AAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC       human-buche
EAFGGDPDLITLFGESAGAASVGFHLLSPHSKGLFRRAVLQSGSPNGPWATIGAAEGRRRAAALGRAVGC       chick-acche
HAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNC       drome-acche
DLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAIIQSGSATSPWAIEPRDVALARAVILYNAMKC       caeel-acche
  ***     * ******  **              *    **    **              *     *


N----LNSDEDLIQCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNAGNFKKT---  317  torma-acche
PPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGL---       human-acche
S----RENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKT---       human-buche
P----YGNETEFLGCLRGKEAADVLEGEGVVMPPQSVFRFAFVPVVDGDFVVDSPDVALWGDYGVKGGEG       chick-acche
-----NASMLKTNPAHVMSCMRSVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADL---       drome-acche
G----NMSLINPDYDRILDCFQRADADALRENEWAPVREFGDFPWVPVVDGDFLLENAQTSLKQGNF---       caeel-acche
                                           *                          


----------------------------------------------------------------------       torma-acche
----------------------------------------------------------------------       human-acche
----------------------------------------------------------------------       human-buche
GHGVEGGDGGYGVKGGDGVKGGYGGGYGARGVREGDGDGGYGVKEGLREGYGVKEGYGVEGDGANAYGAR       chick-acche
----------------------------------------------------------------------       drome-acche
----------------------------------------------------------------------       caeel-acche
                                                                      


----------------------------------------------------------------------       torma-acche
----------------------------------------------------------------------       human-acche
----------------------------------------------------------------------       human-buche
VPPRPHRDETPPDAYGAKGSADAYGAKAAPRPHRDETSPDAYGAKMPPRPHRDEASPDTYGAKMPPRPHR       chick-acche
----------------------------------------------------------------------       drome-acche
----------------------------------------------------------------------       caeel-acche
                                                                      


-----------------------QILLGVNKDEGSFFLLYG-APGFSKDSESKIS--------REDFMSG  355  torma-acche
-----------------------QVLVGVVKDEGSYFLVYG-APGFSKDNESLIS--------RAEFLAG       human-acche
-----------------------QILVGVNKDEGTAFLVYG-APGFSKDNNSIIT--------RKEFQEG       human-buche
DETSPDAYGAKMPPRPHRAGGEVEVLLGAVRVEGSYFLVYG-VPGFGKDNESLIS--------REEFLGG       chick-acche
------------------- KDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALP--------RDKYLEI       drome-acche
------------------- KKTQLLAGSNRDESIYFLTYQLPDIFPVADFFTKTDFIKDRQLWIKGVKD       caeel-acche
                                *   ** *    *                         


VKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNH  425  torma-acche
VRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEH       human-acche
LKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEH       human-buche
VRMGVPQATELAAEAVVLHYTDWLDADNPVKNREALDDIVGDHNVVCPLMAFAQRWAQRGGKVYAYLFDH       chick-acche
MNNIFGKATQAEREAIIFQYTSWE-GNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTH       drome-acche
LLPRQILKCQLTLAAVLHEYEPQDLPVTPRDWINAMDKMLGDYHFTCSVNEMALAHTKHGGDTYYYYFTH       caeel-acche
                   *                    **    *                  * * *


RASNLVWPEWMGVIHGYEIEFVFGLPLV-KELNYTAEEEALSRRIMHYWATFAKTGNPNEPHSQES-KWPL  493  torma-acche
RASTLSWPLWMGVPHGYEIEFIFGIPLD-PSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPP       human-acche
RSSKLPWPEWMGVMHGYEIEFVFGLPLE-RRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNST-SWPV       human-buche
RSSTLLWPSWMGVPHGYEIEFVFGLPLE-PRNNYTREEVELSRRIMRYWGNFARTGDPN--GGVGGPRWPP       chick-acche
RTSTSLWGEWMGVLHGDEIEYFFGQPLN-NSLQYRPVERELGKRMLSAVIEFAKTGNPA--QDGEEWPNFS       drome-acche
RASQQTWPEWMGVLHGYEINFIFGEPLNQKRFNYTDEERELSNRFMRYWANFAKTGDPN--KNEDGSFTQD       caeel-acche
* *   *  **** ** *     * *       *   *             **  * *             






---------LFTTKEQKFIDLNTEPIKVHQRLRVQMCVFWNQFLPKLLNAT                      535  torma-acche
---------VYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT                           human-acche
---------PFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMT                           human-buche
---------PYTPSGQRYAHLNARPLSVGHGLRTQICAFWTRFLPKLLNAT                           chick-acche
---------SKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRSWA                           drome-acche
DVWPKYNSVSMEYMNMTVESSYPSMKRIGHGPRRKECAFWKAYLPNLMAAVADVGDPYLVWKQQMDKWQNE       caeel-acche
                                    * **    *



YITDWQYHFEQYKR    caeel-acche



Readthrough sequences

GNVFAFHMQKVRTPAKTYHFGVIVAHLLLLSLPTASDVPRLASSKWWAHSDPLCSRRCWESWGRIL torma-acche GMQGPAGSGWEEGSGSPPGVTPLFSP human-acche GRRMEWGEQGMHKAARVGRRGERWGAKHRV mouse-acche GRR-GVGKQGMHKAARVGRTGERKGGKHRM ratno-acche

H peptides

ACDGELSSSGTSSSKGIIFYVLFSILYLIFY torma-acche ASEAPSTCPGFTHGEAAPRPGLPLPLLLLHQLLLLFLSHLRRL human-acche ATEAPCTCPSPAHGEAAPRPGPDLALSLLFFLFLL-HSGLPWL mouse-acche ATEVPCTCPSPAHGEAAPRPGPALSLSLLFFLFLL-HSGLRWL ratno-acche GTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF drome-acche *

T peptides

ETIDEAERQWKTEFHRWSS-YMMHWKNQFDQY-SRHEN-------CAEL torma-acche DTLDEAERQWKAEFHRWSS-YMVHWKNQFDHY-SKQDR-------CSDL human-acche GNIDEAEWEWKAGFHRWNN-YMMDWKNQFNDYTSKKES-------CVGL human-buche GPPEDAEREWRLEFHRWSS-YMGRWRTQFEHY-SRQQP-------CATL chick-acche AAVADVGDPYLVWKQQMDKWQNEYITDWQYHFEQYKRYQTYRQSDSETCGG caeel-acche * * * * * * ^ * splicing site Note that the eighth exon deduced peptide of C. elegans AChE has been added to the begining of the T peptides alignment to illustrate the conservation of regular spacing between aromatic residues.
Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer