ESTHER Database

Home
Search
Tools
Families
Biological
data
Basics on AChE
ESTHER definition
What is up?
Acknowledgments
& disclaimer


2nd coding mammals

Second coding exon -> mammals AChE


                              MREMNLLVTSSLGVLLHLVVLCQADDDSELLVNTKSGKVM  16   torma-ACHE
                     MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLR       human-ACHE
                            MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVR       human-BCHE
                            MAPLFLLLLLLLSPSPTSAHRFAYSAPNRPEVRTTTGSVRGL       chick-ACHE
                 MAISCRQSRVLPMSLPLPLTIPLPLVLVLSLHLSGVCGVIDRLVVQTSSGPVR       drome-ACHE
                                       MRNSLLFFIFLPSTILAVDLIHLHDGSPLFG       caeel-ACHE
                                                                      


RTRIPVLSSHISAFLGIPFAEPPVGNMRFRRPEP-KKPWSGVWNASTYPNNCQQYVDEQFPGFPGSEMWN  85   torma-ACHE
GIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEP-KQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWN       human-ACHE
GMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQS-LTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWN       human-BCHE
LIPAGPSGSTAAAFLGIPFAVPPLGPLRFRPPLPIPTPWTGIRDADSQPFACYQMVDTTFPGFQGSEMWN       chick-ACHE
GRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVP-AEPWHGVLDATGLSATCVQERYEYFPGFSGEEIWN       drome-ACHE
EEVLSQTGKPLTRFQGIPFAEPPVGNLRFKKPKP-KQPWRIPLNATTPPNSCIQSEDTYFGDFYGSTMWN       caeel-ACHE
               * *   **    **  *      *     *      * *        * *   **


PNREMSEDCLYLNIWVPS---------------------------------PRPKSA-TVMLWIYGGGFY  121  torma-ACHE
PNRELSEDCLYLNVWTPY---------------------------------PRPTSPTPVLVWIYGGGFY       human-ACHE
PNTDLSEDCLYLNVWIPA---------------------------------PKPKNA-TVLIWIYGGGFQ       human-BCHE
PNREMSEDCLYLNVWTQK---------------------------------GDPTEP-PVLVWIYGGGFT       chick-ACHE
PNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGL-PILIWIYGGGFM       drome-ACHE
ANTKLSEDCLYLNVYVPGKV-------------------------------DPNKKL-AVMVWVYGGGFW       caeel-ACHE
 *   ****** *                                                 * ***** 


SGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG-------SQEAPGNMGLLDQRMALQWVHDNI  184  torma-ACHE
SGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPG-------SREAPGNVGLLDQRLALQWVQENV       human-ACHE
TGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPG-------NPEAPGNMGLFDQQLALQWVQKNI       human-BCHE
GGSVSLDVYDGRYLAAAEEAVVVSMNYRVGSLGFLALAG-------HRDAPGNVGLWDQRLALQWVRDNA       chick-ACHE
TGSATLDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAE-EAPGNVGLWDQALAIRWLKDNA       drome-ACHE
SGTATLDVYDGRILTVEENVILVAMNYRVSIFGFLYMNR-------P-EAPGNMGMWDQLLAMKWVHKNI       caeel-ACHE
 *   *  *                 ***   **               **** *  **  *      * 


QFFGGDPKTVTLFGESAGRASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELRRNLNC  254  torma-ACHE
AAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGC       human-ACHE
AAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC       human-BCHE
EAFGGDPDLITLFGESAGAASVGFHLLSPHSKGLFRRAVLQSGSPNGPWATIGAAEGRRRAAALGRAVGC       chick-ACHE
HAFGGNPEWMTLFGESAGSSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNC       drome-ACHE
DLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAIIQSGSATSPWAIEPRDVALARAVILYNAMKC       caeel-ACHE
  ***     * ******  **              *    **    **              *     *


N----LNSDEDLIQCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNAGNFKKT---  317  torma-ACHE
PPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGL---       human-ACHE
S----RENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKT---       human-BCHE
P----YGNETEFLGCLRGKEAADVLEGEGVVMPPQSVFRFAFVPVVDGDFVVDSPDVALWGDYGVKGGEG       chick-ACHE
-----NASMLKTNPAHVMSCMRSVDAKTISVQQWNSYSGILSFPSAPTIDGAFLPADPMTLMKTADL---       drome-ACHE
G----NMSLINPDYDRILDCFQRADADALRENEWAPVREFGDFPWVPVVDGDFLLENAQTSLKQGNF---       caeel-ACHE
                                           *                          


----------------------------------------------------------------------       torma-ACHE
----------------------------------------------------------------------       human-ACHE
----------------------------------------------------------------------       human-BCHE
GHGVEGGDGGYGVKGGDGVKGGYGGGYGARGVREGDGDGGYGVKEGLREGYGVKEGYGVEGDGANAYGAR       chick-ACHE
----------------------------------------------------------------------       drome-ACHE
----------------------------------------------------------------------       caeel-ACHE
                                                                      


----------------------------------------------------------------------       torma-ACHE
----------------------------------------------------------------------       human-ACHE
----------------------------------------------------------------------       human-BCHE
VPPRPHRDETPPDAYGAKGSADAYGAKAAPRPHRDETSPDAYGAKMPPRPHRDEASPDTYGAKMPPRPHR       chick-ACHE
----------------------------------------------------------------------       drome-ACHE
----------------------------------------------------------------------       caeel-ACHE
                                                                      


-----------------------QILLGVNKDEGSFFLLYG-APGFSKDSESKIS--------REDFMSG  355  torma-ACHE
-----------------------QVLVGVVKDEGSYFLVYG-APGFSKDNESLIS--------RAEFLAG       human-ACHE
-----------------------QILVGVNKDEGTAFLVYG-APGFSKDNNSIIT--------RKEFQEG       human-BCHE
DETSPDAYGAKMPPRPHRAGGEVEVLLGAVRVEGSYFLVYG-VPGFGKDNESLIS--------REEFLGG       chick-ACHE
------------------- KDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALP--------RDKYLEI       drome-ACHE
------------------- KKTQLLAGSNRDESIYFLTYQLPDIFPVADFFTKTDFIKDRQLWIKGVKD       caeel-ACHE
                                *   ** *    *                         


VKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNH  425  torma-ACHE
VRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEH       human-ACHE
LKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFEH       human-BCHE
VRMGVPQATELAAEAVVLHYTDWLDADNPVKNREALDDIVGDHNVVCPLMAFAQRWAQRGGKVYAYLFDH       chick-ACHE
MNNIFGKATQAEREAIIFQYTSWE-GNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTH       drome-ACHE
LLPRQILKCQLTLAAVLHEYEPQDLPVTPRDWINAMDKMLGDYHFTCSVNEMALAHTKHGGDTYYYYFTH       caeel-ACHE
                   *                    **    *                  * * *


RASNLVWPEWMGVIHGYEIEFVFGLPLV-KELNYTAEEEALSRRIMHYWATFAKTGNPNEPHSQES-KWPL  493  torma-ACHE
RASTLSWPLWMGVPHGYEIEFIFGIPLD-PSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPP       human-ACHE
RSSKLPWPEWMGVMHGYEIEFVFGLPLE-RRDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNST-SWPV       human-BCHE
RSSTLLWPSWMGVPHGYEIEFVFGLPLE-PRNNYTREEVELSRRIMRYWGNFARTGDPN--GGVGGPRWPP       chick-ACHE
RTSTSLWGEWMGVLHGDEIEYFFGQPLN-NSLQYRPVERELGKRMLSAVIEFAKTGNPA--QDGEEWPNFS       drome-ACHE
RASQQTWPEWMGVLHGYEINFIFGEPLNQKRFNYTDEERELSNRFMRYWANFAKTGDPN--KNEDGSFTQD       caeel-ACHE
* *   *  **** ** *     * *       *   *             **  * *             






---------LFTTKEQKFIDLNTEPIKVHQRLRVQMCVFWNQFLPKLLNAT                      535  torma-ACHE
---------VYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT                           human-ACHE
---------PFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMT                           human-BCHE
---------PYTPSGQRYAHLNARPLSVGHGLRTQICAFWTRFLPKLLNAT                           chick-ACHE
---------SKEDPVYYIFSTDDKIEKLARGPLAARCSFWNDYLPKVRSWA                           drome-ACHE
DVWPKYNSVSMEYMNMTVESSYPSMKRIGHGPRRKECAFWKAYLPNLMAAVADVGDPYLVWKQQMDKWQNE       caeel-ACHE
                                    * **    *



YITDWQYHFEQYKR    caeel-ACHE



Readthrough sequences

GNVFAFHMQKVRTPAKTYHFGVIVAHLLLLSLPTASDVPRLASSKWWAHSDPLCSRRCWESWGRIL torma-ACHE GMQGPAGSGWEEGSGSPPGVTPLFSP human-ACHE GRRMEWGEQGMHKAARVGRRGERWGAKHRV mouse-ACHE GRR-GVGKQGMHKAARVGRTGERKGGKHRM ratno-ACHE

H peptides

ACDGELSSSGTSSSKGIIFYVLFSILYLIFY torma-ACHE ASEAPSTCPGFTHGEAAPRPGLPLPLLLLHQLLLLFLSHLRRL human-ACHE ATEAPCTCPSPAHGEAAPRPGPDLALSLLFFLFLL-HSGLPWL mouse-ACHE ATEVPCTCPSPAHGEAAPRPGPALSLSLLFFLFLL-HSGLRWL ratno-ACHE GTCDGDSGSASISPRLQLLGIAALIYICAALRTKRVF drome-ACHE *

T peptides

ETIDEAERQWKTEFHRWSS-YMMHWKNQFDQY-SRHEN-------CAEL torma-ACHE DTLDEAERQWKAEFHRWSS-YMVHWKNQFDHY-SKQDR-------CSDL human-ACHE GNIDEAEWEWKAGFHRWNN-YMMDWKNQFNDYTSKKES-------CVGL human-BCHE GPPEDAEREWRLEFHRWSS-YMGRWRTQFEHY-SRQQP-------CATL chick-ACHE AAVADVGDPYLVWKQQMDKWQNEYITDWQYHFEQYKRYQTYRQSDSETCGG caeel-ACHE * * * * * * ^ * splicing site Note that the eighth exon deduced peptide of C. elegans AChE has been added to the begining of the T peptides alignment to illustrate the conservation of regular spacing between aromatic residues.

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer