ESTHER Database

Basics on AChE
ESTHER definition
What is up?
& disclaimer

H peptides

H peptides

                                       MRNSLLFFIFLPSTILAVDLIHLHDGSPLFG       caeel-ACHE

               * *   **    **  *      *     *      * *        * *   **

PNREMSEDCLYLNIWVPS---------------------------------PRPKSA-TVMLWIYGGGFY  121  torma-ACHE
PNRELSEDCLYLNVWTPY---------------------------------PRPTSPTPVLVWIYGGGFY       human-ACHE
PNTDLSEDCLYLNVWIPA---------------------------------PKPKNA-TVLIWIYGGGFQ       human-BCHE
PNREMSEDCLYLNVWTQK---------------------------------GDPTEP-PVLVWIYGGGFT       chick-ACHE
ANTKLSEDCLYLNVYVPGKV-------------------------------DPNKKL-AVMVWVYGGGFW       caeel-ACHE
 *   ****** *                                                 * ***** 

 *   *  *                 ***   **               **** *  **  *      * 

  ***     * ******  **              *    **    **              *     *


----------------------------------------------------------------------       torma-ACHE
----------------------------------------------------------------------       human-ACHE
----------------------------------------------------------------------       human-BCHE
----------------------------------------------------------------------       drome-ACHE
----------------------------------------------------------------------       caeel-ACHE

----------------------------------------------------------------------       torma-ACHE
----------------------------------------------------------------------       human-ACHE
----------------------------------------------------------------------       human-BCHE
----------------------------------------------------------------------       drome-ACHE
----------------------------------------------------------------------       caeel-ACHE

-----------------------QILLGVNKDEGSFFLLYG-APGFSKDSESKIS--------REDFMSG  355  torma-ACHE
-----------------------QVLVGVVKDEGSYFLVYG-APGFSKDNESLIS--------RAEFLAG       human-ACHE
-----------------------QILVGVNKDEGTAFLVYG-APGFSKDNNSIIT--------RKEFQEG       human-BCHE
                                *   ** *    *                         

                   *                    **    *                  * * *

* *   *  **** ** *     * *       *   *             **  * *             

                                    * **    *


Readthrough sequences


H peptides


T peptides

ETIDEAERQWKTEFHRWSS-YMMHWKNQFDQY-SRHEN-------CAEL torma-ACHE DTLDEAERQWKAEFHRWSS-YMVHWKNQFDHY-SKQDR-------CSDL human-ACHE GNIDEAEWEWKAGFHRWNN-YMMDWKNQFNDYTSKKES-------CVGL human-BCHE GPPEDAEREWRLEFHRWSS-YMGRWRTQFEHY-SRQQP-------CATL chick-ACHE AAVADVGDPYLVWKQQMDKWQNEYITDWQYHFEQYKRYQTYRQSDSETCGG caeel-ACHE * * * * * * ^ * splicing site Note that the eighth exon deduced peptide of C. elegans AChE has been added to the begining of the T peptides alignment to illustrate the conservation of regular spacing between aromatic residues.

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

Acknowledgements and disclaimer