General
Type : Natural,Peptide
Chemical_Nomenclature : TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY
Canonical SMILES :
InChI :
InChIKey :
Other name(s) :
MW : 7 kD
Formula :
CAS_number :
PubChem :
UniChem :
IUPHAR :
Wikipedia :
References (7)
| Title : Conformational comparison in the snake toxin family - Falkenstein_1996_Int.J.Pept.Protein.Res_47_167 |
| Author(s) : Falkenstein RJ , Pena C , Biscoglio MJ , Bonino DJ |
| Ref : Int J Pept Protein Res , 47 :167 , 1996 |
| Abstract : Falkenstein_1996_Int.J.Pept.Protein.Res_47_167 |
| ESTHER : Falkenstein_1996_Int.J.Pept.Protein.Res_47_167 |
| PubMedSearch : Falkenstein_1996_Int.J.Pept.Protein.Res_47_167 |
| PubMedID: 8740966 |
| Title : Muscarinic toxins from the venom of Dendroaspis snakes with agonist-like actions - Jerusalinsky_1995_Toxicon_33_389 |
| Author(s) : Jerusalinsky D , Kornisiuk E , Bernabeu R , Izquierdo I , Cervenansky C |
| Ref : Toxicon , 33 :389 , 1995 |
| Abstract : Jerusalinsky_1995_Toxicon_33_389 |
| ESTHER : Jerusalinsky_1995_Toxicon_33_389 |
| PubMedSearch : Jerusalinsky_1995_Toxicon_33_389 |
| PubMedID: 7570625 |
| Title : 1.9-A resolution structure of fasciculin 1, an anti- acetylcholinesterase toxin from green mamba snake venom - le Du_1992_J.Biol.Chem_267_22122 |
| Author(s) : le Du MH , Marchot P , Bougis PE , Fontecilla-Camps JC |
| Ref : Journal of Biological Chemistry , 267 :22122 , 1992 |
| Abstract : le Du_1992_J.Biol.Chem_267_22122 |
| ESTHER : le Du_1992_J.Biol.Chem_267_22122 |
| PubMedSearch : le Du_1992_J.Biol.Chem_267_22122 |
| PubMedID: 1429564 |
| Title : Preliminary X-ray analysis of crystals of fasciculin 1, a potent acetylcholinesterase inhibitor from green mamba venom - Menez_1990_J.Mol.Biol_216_233 |
| Author(s) : Menez R , Ducruix A |
| Ref : Journal of Molecular Biology , 216 :233 , 1990 |
| Abstract : Menez_1990_J.Mol.Biol_216_233 |
| ESTHER : Menez_1990_J.Mol.Biol_216_233 |
| PubMedSearch : Menez_1990_J.Mol.Biol_216_233 |
| PubMedID: 2254925 |
| Title : Rat striatal acetylcholinesterase inhibition by fasciculin (a polypeptide from green mamba snake venom) - Dajas_1987_Neurosci.Lett_77_87 |
| Author(s) : Dajas F , Bolioli B , Castello ME , Silveira R |
| Ref : Neuroscience Letters , 77 :87 , 1987 |
| Abstract : Dajas_1987_Neurosci.Lett_77_87 |
| ESTHER : Dajas_1987_Neurosci.Lett_77_87 |
| PubMedSearch : Dajas_1987_Neurosci.Lett_77_87 |
| PubMedID: 3601220 |
| Title : Anticholinesterase toxins - |
| Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D |
| Ref : Pharmacol Ther , 30 :259 , 1985 |
| PubMedID: 3842891 |
| Title : Fasciculins, anticholinesterase toxins from the venom of the green mamba Dendroaspis angusticeps - Karlsson_1984_J.Physiol.(Paris)_79_232 |
| Author(s) : Karlsson E , Mbugua PM , Rodriguez-Ithurralde D |
| Ref : Journal de Physiologie (Paris) , 79 :232 , 1984 |
| Abstract : Karlsson_1984_J.Physiol.(Paris)_79_232 |
| ESTHER : Karlsson_1984_J.Physiol.(Paris)_79_232 |
| PubMedSearch : Karlsson_1984_J.Physiol.(Paris)_79_232 |
| PubMedID: 6530667 |