Substrate

Bibliography

Biblio print

Tree Display

AceDB Schema

XML Display

Feedback

Substrate Report for: Alpha-amanitin-proprotein

25mer macrocyclization substrate: IWGIGCNPWTAEHVDQTLASGNDIC. The 25mer is the post proline product (A0A067SLB9 AAMA1_GALM3) Major toxin belonging to the bicyclic octapeptides amatoxins that acts by binding non-competitively to RNA polymerase II and greatly slowing the elongation of transcripts from target promoters


General
Type Natural, Toxin, Peptide
Chemical_Nomenclature
Canonical SMILES
InChI
InChIKey
Other name(s) MFDTNATRLPIWGIGCNPWTAEHVDQTLASGNDIC ; Alpha-amanitin proprotein ; H2E7Q5 ; AMA1-1 ; AEX26935
________________________________________________________________________________________________
MW|
Formula|
CAS_number|
PubChem|
UniChem|
IUPHAR|
Wikipedia|

Target
Families | Alpha-amanitin-proprotein ligand of proteins in family: S9N_PPCE_Peptidase_S9
Stucture | 4 structures (e.g. : 5N4B, 5N4C, 5N4D... more)
Protein | 9agar-h2e7q8

References:
Search PubMed for references concerning: Alpha-amanitin-proprotein
    Title: Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates
    Czekster CM, Ludewig H, McMahon SA, Naismith JH
    Ref: Nat Commun, 8:1045, 2017 : PubMed