Tree Display

AceDB Schema

XML Display

Feedback

Peptide Report for: volca-d8tpu8

Name Class
volca-d8tpu8VHAAFGRTAPLAGGGPGLPNVYEGSWVETFNQAGFSVCGLDHQGYGRSKGARFGIKFQTHVDNLLMLSGDVLENDNTAFPKGLPYFLVGHSLGGLLATLACLHQPQLFTGLILLSPLLSLDRPIAKRNNSLRSLSLMSFSVHVFYVFCCYTC

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer