Reference sequence (1): 9bact-3WYDseq
Identities normalised by aligned length.
Colored by: consensus/70% and property
 1 9bact-3WYDseq    100.0%  ------------------------------------------------------------------------------------------------------------------------ 
 2 solue-Q029Y4      56.6%  ------------------------------------------------------------------------------------------------------------------------ 
 3 9bact-b8y567      28.8%  ---------------------------MLAAI-----------------------------------------------------LCLVIGD------TSLAER---------------- 
 4 9bact-b8y568      26.0%  ---------------------------MRNFIYSTRTTPLTV-------------------------------------------AASLIAW------VSLSTS---------------- 
 5 9zzzz-EH82        33.5%  ---------------------------MRT------------------------------------------------------------------------------------------ 
 6 9bact-estC55.241  27.2%  ---------------------------MSQHRNI---------------------------------------------------VAFLL---------ALAAL---------------- 
 7 9bact-estC55.165  24.1%  ---------------------------MHSSSTTLW------------------------------------------------GLSLLL-----LI--ALVVP---------------- 
 8 9bact-estC76.137  25.2%  ---------------------------------------------------------------------------------------MLL-----LI--ALVVP---------------- 
 9 9zzzz-t1ci96      20.5%  ---------------------------MS------------------------------------------------------------------------------------------- 
10 xanax-XAC2981     20.6%  ---------------------------MIRR------------------------------------------------------CLVVI-----AF--ALLLA---------------- 
11 xanor-q5h3e2      20.6%  ---------------------------MIRR------------------------------------------------------CLVVI-----VL--ALLVA---------------- 
12 xanca-XCC2811     20.3%  ----------------------------MRC------------------------------------------------------CLLLV-----VL--ALLLP---------------- 
13 rhoba-q7ule9      21.1%  ---------------------------MKRSPHAS--------------------------------------------------FVLIFA-------STIVAM---------------- 
14 rhofd-q21zf7      24.9%  ---------------------------MDEIVTK---------------------------------------------------IFSLV-----TL-TTVTFLL--------------- 
15 symth-q67nt3      26.0%  ---------------------------MAPAELDRE------------------------------------------------------------------------------------ 
16 rhime-RB0531      24.8%  ---------------------------MLRGILP---------------------------------------------------LAAIA-----AL--GLFDP---------------- 
17 flaj1-a5fe33      21.2%  ---------------------------MKNT------------------------------------------------------LAFLF-----LL-LSIVVF---------------- 
18 bacfr-q64n33      25.1%  ---------------------------MKQFVLF---------------------------------------------------FISLF-----LL--GVGAR---------------- 
19 bactn-BT3286      23.0%  ---------------------------MKQWSIL---------------------------------------------------LVFL------SL--SLSLS---------------- 
20 bacsk-q5wbk1      25.9%  ---------------------------ITTS----------------------------------------------------------------------------------------- 
21 thema-TM0033      17.2%  ---------------------------MLFFIFMGI-------------------------------------------------LSILFAQEDVTV-KSVTLITKV--------FPEGE 
22 anavt-q3m5j3      23.3%  ---------------------------MS------------------------------------------------------------------------------------------- 
23 nosco-q3i1p4      24.2%  ---------------------------MP------------------------------------------------------------------------------------------- 
24 actsz-a6vkk1      19.6%  ---------------------------LAKAQLTQS-----------------------------------------------------------AVAGKVKTL---------------- 
25 pasmu-PM1358      17.5%  ------------------------------------------------------------------------------------------------------------------------ 
26 myxxd-q1cxe9      16.4%  ---------------------------------------------------------------------------------------------------ELTVT---------------- 
27 stiad-q09av6      15.4%  ---------------------------------------------------------------------------------------------------QLTVT---------------- 
28 halo1-d0lmj0      15.9%  ---------------------------MKRIVYLSV-------------------------------------------------MASLLA----------------------------- 
29 stiad-q09db1      16.5%  ---------------------------MSRRG-------------------------------------------------------VVL-----AL--SLLVV---------------- 
30 mycua-a0pqs2      25.4%  ------------------------------------------------------------------------------------------------------------------------ 
31 braja-BLL1350     14.0%  ---------------------------MTEAVVDD--------------------------------------------------IVAVLPP---LL-NALEALGFFTRHLHPPAFASVM 
32 rhopa-q6ncc5      16.3%  ---------------------------MSEAVIDD--------------------------------------------------IVALLPP---LL-QSLESLGFVARYLHPPEFGDLL 
33 rhopa-q37hi0      14.7%  ---------------------------MSDAVVDD--------------------------------------------------IVALLPP---LL-QSIEALGFIARYLHPPEFGEVM 
34 pseal-PHAZ        16.1%  ---------------------------MPLRTLLCG-----------------------------------------------LLLAACLGE------HALAASR--------------- 
35 psefl-phaz        16.1%  ---------------------------MPLRTLLCG-----------------------------------------------LLLAVCLGQ------HALAASR--------------- 
36 psepa-q6vqy9      12.8%  ---------------------------MSRD-------------------------------------------------------------------NAIVMR---------------- 
37 bacha-BH2917      11.5%  ---------------------------MIS------------------------------------------------------------------------------------------ 
38 bacsu-YITV        13.8%  ---------------------------MIQ------------------------------------------------------------------------------------------ 
39 lisin-LIN2363     12.6%  ---------------------------MIQ------------------------------------------------------------------------------------------ 
40 lismo-LMO2262     12.6%  ---------------------------MIQ------------------------------------------------------------------------------------------ 
41 oceih-OB1195      13.9%  ---------------------------MIG------------------------------------------------------------------------------------------ 
42 ecoli-yjfp        13.8%  ---------------------------MIE------------------------------------------------------------------------------------------ 
43 shifl-YJFP        13.8%  ---------------------------MIE------------------------------------------------------------------------------------------ 
44 salty-YJFP        12.3%  ---------------------------MIA------------------------------------------------------------------------------------------ 
45 entcc-a0a0h3cfu5  13.8%  ---------------------------MIE------------------------------------------------------------------------------------------ 
46 entcl-a0a157v5g4  13.2%  ---------------------------MIT------------------------------------------------------------------------------------------ 
47 erwct-q6d134      14.9%  ---------------------------MVE------------------------------------------------------------------------------------------ 
48 yerpe-Y0644       14.6%  ------------------------------------------------------------------------------------------------------------------------ 
49 entfa-EF2792      13.4%  ---------------------------MKIS----------------------------------------------------------------------------------------- 
50 lacss-q38vr0      13.1%  ---------------------------MAL------------------------------------------------------------------------------------------ 
51 lacpl-LP.1760     15.2%  ---------------------------MIK------------------------------------------------------------------------------------------ 
52 entfc-q3xxj0      12.4%  ---------------------------MNPI----------------------------------------------------------------------------------------- 
53 lacpl-LP.2631     12.5%  ---------------------------M-------------------------------------------------------------------------------------------- 
54 aciac-a1tlq0      11.9%  MVRFLQHVLQPARARRTFPPDRNLFISMKRWP-----------------------------------------------------LFSSL------A-LALAVTA--------------- 
55 polna-a1vle4      11.5%  ---------------------------MKHWP-----------------------------------------------------ILSTL------L-LTFAILA--------------- 
56 polsj-q128b8      11.6%  ---------------------------MKRWH-----------------------------------------------------LFTSF------C-AALALMA--------------- 
57 comte-a0hgv8      12.0%  ---------------------------MPKTSRFCSPRR----------------------------------------------LAAALGLA--LL-LALAIW---------------- 
58 pse14-q48gq9      13.4%  MR------------------------LMPISPLARFKA-----------------------RPIKW-----------------V-CMLAI------I-IGLPV----------------- 
59 pseu2-q4zr46      13.6%  --------------------------------------------------------------------------------------MTTI------I-LGLPV----------------- 
60 psesy-PSPTO3572   12.9%  ---------------------------MAISLLARFKA-----------------------RPIRW-----------------V-LMAAI------I-LGLPV----------------- 
61 psef5-q4kaz4      10.7%  MVK----------------P------CMSPTLPQRLRR-----------------------RWFSL-----------------L-CMAAL------V-VGLPV----------------- 
62 psepf-q3kew2      12.3%  ---------------------------MFLAFMTRVRR-----------------------RRLAF-----------------A-CMAAL------I-VGVPA----------------- 
63 psepu-a1fc94      10.6%  ---------------------------MPTYFLTHLRR-----------------------RWLTW-----------------L-CATFL------V-VGLPA----------------- 
64 borpe-q7vsl4      13.6%  ---------------------------MVSLPF-----------------------------RLSW-----------------RRMAAVL------L-LAAGAL---------------- 
65 chrvo-q7nww4      10.4%  ---------------------------MTKAS-----------------------------------------------------LIFLM--------TATILL---------------- 
66 synp6-q5n0k4      13.0%  ---------------------------MLLRSL----------------------------------------------------LLILLGC------GSVVLL---------------- 
67 lepin-LA3770      10.1%  ---------------------------MYKFLKYS-------------CI-----------------------------------LFLLLEVF--------------------------- 
68 cupnh-q0k226       7.5%  ---------------------------MPEGPRPAQPE-----------------------SRHRW-----------------LATAAALAV---------------------------- 
69 cupnh-q0jzs8       9.4%  ---------------------------MPLITRRT--------------------------------------------------LAAALMTA-SGF----------------------- 
70 ralme-q1lg65       9.4%  ---------------------------MFSLLRRT--------------------------------------------------LAATLVTA-GGF----------------------- 
71 phopr-Q93CF7      10.5%  ---------------------------MKST------------------------------------------------------LTTILL-I-YII----------------------- 
72 mimiv-yr595       10.6%  ---------------------------MYKK------------------------------------------------------ILIIL-----II-IIIVIIS--------------- 
73 enccu-ECU09.0730   7.5%  ---------------------------MTPVLYFIPTIVVPVFVIIWGCLHSILIRPHPTFCRQAWVPACPDIKMDFFPPSMELGLAAMLSM--YTI-LGVVILS--------------L 
74 dicdi-q54f01      10.2%  ------------------------------------------------------------------------------------------------------------------------ 
75 plafa-MAL7P1.156   9.0%  ---------------------------MGNT----------------------------------------------------------------------------------------- 
76 thean-q4ue56       7.9%  ---------------------------MGN------------------------------------------------------------------------------------------ 
77 thepa-q4n5d6       6.3%  ---------------------------MGN------------------------------------------------------------------------------------------ 
78 butfi-CINII       12.5%  ---------------------------MKKG------------------------------------------------------VFTLLT-------ASLCLLA--------------- 
   consensus/100%           ........................................................................................................................ 
   consensus/90%            ........................................................................................................................ 
   consensus/80%            ...........................M............................................................................................ 
   consensus/70%            ...........................M............................................................................................ 

 1 9bact-3WYDseq    100.0%  ------------------------------------------------------------------------------------------------------------------------ 
 2 solue-Q029Y4      56.6%  ------------------------------------------------------------------------------------------------------------------------ 
 3 9bact-b8y567      28.8%  -------------------------------------------------------------------------------DPTDDERSI-------------------------------- 
 4 9bact-b8y568      26.0%  -------------------------------------------------------------------------------LHAQSEASS-------------------------------- 
 5 9zzzz-EH82        33.5%  ------------------------------------------------------------------------------------------------------------------------ 
 6 9bact-estC55.241  27.2%  ----------------------------------------------------------------------------GAGSQASGQT---------------------------------- 
 7 9bact-estC55.165  24.1%  --------------------------------------------------------------------------------PARAQ----------------------------------- 
 8 9bact-estC76.137  25.2%  --------------------------------------------------------------------------------PARAQ----------------------------------- 
 9 9zzzz-t1ci96      20.5%  ------------------------------------------------------------------------------------------------------------------------ 
10 xanax-XAC2981     20.6%  -GCSS------------------------------------------------------------------------------------------------------------------- 
11 xanor-q5h3e2      20.6%  -GCSS------------------------------------------------------------------------------------------------------------------- 
12 xanca-XCC2811     20.3%  -GCSS------------------------------------------------------------------------------------------------------------------- 
13 rhoba-q7ule9      21.1%  -NC-----------------------------------------------------------------------------PSSNDLSAQDSASSDVESAS-------------------- 
14 rhofd-q21zf7      24.9%  GGCAMS-------------------------------------------------------------------------EPWT------------------------------------- 
15 symth-q67nt3      26.0%  ------------------------------------------------------------------------------------------------------------------------ 
16 rhime-RB0531      24.8%  ------------------------------------------------------------------------------------------------------------------------ 
17 flaj1-a5fe33      21.2%  ------------------------------------------------------------------------------------------------------------------------ 
18 bacfr-q64n33      25.1%  ------------------------------------------------------------------------------------------------------------------------ 
19 bactn-BT3286      23.0%  ------------------------------------------------------------------------------------------------------------------------ 
20 bacsk-q5wbk1      25.9%  --------------------------------------------------------------------------DGQQLPPTSDEVVSTGERSP-------------------------- 
21 thema-TM0033      17.2%  KVCAV--------------------------------------------------------VIEYPVE-----IDGQKLSPDQFSVKVKTGDTYSSRTITKVYANNSGGLSFSIFNNRGK 
22 anavt-q3m5j3      23.3%  ------------------------------------------------------------------------------------------------------------------------ 
23 nosco-q3i1p4      24.2%  ------------------------------------------------------------------------------------------------------------------------ 
24 actsz-a6vkk1      19.6%  ------------------------------------------------------------------------------------------------------------------------ 
25 pasmu-PM1358      17.5%  ------------------------------------------------------------------------------------------------------------------------ 
26 myxxd-q1cxe9      16.4%  ---------------------------------------------------------------------------DDDGATASDRMKVQVTPAP-------------------------- 
27 stiad-q09av6      15.4%  ---------------------------------------------------------------------------DDDGASASSKTTVTVNPAP-------------------------- 
28 halo1-d0lmj0      15.9%  -ACGD-------------------------------------------DGGDDGGAETDAAVAIDASPVDA--PDPIDAAPDANQIDAMVDDRP-------------------------- 
29 stiad-q09db1      16.5%  -ACGG--------------------------------------------------------GVEELEP--------SPLGTQTSGLSITVEDQV-------------------------- 
30 mycua-a0pqs2      25.4%  ------------------------------------------------------------------------------------------------------------------------ 
31 braja-BLL1350     14.0%  NAIGAPDDALQAAHSAIGTWPEQFAGLRDRLDGACNETLAAFAGIREVERGNGDLVAVFRALRHVPRALEALYPLALQFPPVSSFFLNAARREDEI------------------------ 
32 rhopa-q6ncc5      16.3%  KLAGTPDEALQTELPRLANWPETFAHLRGPLQTAGEQALTAFAGLRAVDAGQGDLGDVFRALRHLPQALEALYPLAANLPPVSSFFLDPDNQQNEA------------------------ 
33 rhopa-q37hi0      14.7%  RLAGAPDAQLRSELPRVAKWPDQFAHLREPLRMAGDHALAAFDGLRTVDSGAGDLGAVFRALRHLPQALEALYPLAATLPPVSGLYLDPALQQDEA------------------------ 
34 pseal-PHAZ        16.1%  ------------------------------------------------------CSERPRTLL----------------RPAEVSCS--------------------------------- 
35 psefl-phaz        16.1%  ------------------------------------------------------CSERPRTLL----------------RPAEVSCS--------------------------------- 
36 psepa-q6vqy9      12.8%  ------------------------------------------------------------------------------------------------------------------------ 
37 bacha-BH2917      11.5%  ------------------------------------------------------------------------------------------------------------------------ 
38 bacsu-YITV        13.8%  ------------------------------------------------------------------------------------------------------------------------ 
39 lisin-LIN2363     12.6%  ------------------------------------------------------------------------------------------------------------------------ 
40 lismo-LMO2262     12.6%  ------------------------------------------------------------------------------------------------------------------------ 
41 oceih-OB1195      13.9%  ------------------------------------------------------------------------------------------------------------------------ 
42 ecoli-yjfp        13.8%  ------------------------------------------------------------------------------------------------------------------------ 
43 shifl-YJFP        13.8%  ------------------------------------------------------------------------------------------------------------------------ 
44 salty-YJFP        12.3%  ------------------------------------------------------------------------------------------------------------------------ 
45 entcc-a0a0h3cfu5  13.8%  ------------------------------------------------------------------------------------------------------------------------ 
46 entcl-a0a157v5g4  13.2%  ------------------------------------------------------------------------------------------------------------------------ 
47 erwct-q6d134      14.9%  ------------------------------------------------------------------------------------------------------------------------ 
48 yerpe-Y0644       14.6%  ------------------------------------------------------------------------------------------------------------------------ 
49 entfa-EF2792      13.4%  ------------------------------------------------------------------------------------------------------------------------ 
50 lacss-q38vr0      13.1%  ------------------------------------------------------------------------------------------------------------------------ 
51 lacpl-LP.1760     15.2%  ------------------------------------------------------------------------------------------------------------------------ 
52 entfc-q3xxj0      12.4%  ------------------------------------------------------------------------------------------------------------------------ 
53 lacpl-LP.2631     12.5%  ------------------------------------------------------------------------------------------------------------------------ 
54 aciac-a1tlq0      11.9%  -GCAT-------------------------------------------------LDAKQREWIF---------------QPSDRAW-GGAQSTDDM------------------------ 
55 polna-a1vle4      11.5%  -GCAT-------------------------------------------------LDEQQRGWIF---------------QPSDRSWGGSAELARDM------------------------ 
56 polsj-q128b8      11.6%  -GCAT-------------------------------------------------LDEKQRDWIF---------------QPSDRTWSGGAAAAEGM------------------------ 
57 comte-a0hgv8      12.0%  -GMRE-------------------------------------------------IDARQRVWIF---------------QPSDRSWPGANTA--GM------------------------ 
58 pse14-q48gq9      13.4%  -GCAV-------------------------------------------------LEHKERELVFRI-------------EPGTASWYSGLPA--DV------------------------ 
59 pseu2-q4zr46      13.6%  -GCAV-------------------------------------------------LEHKERQLVFRI-------------EPGTASWYSGLPA--DV------------------------ 
60 psesy-PSPTO3572   12.9%  -GCAV-------------------------------------------------LEHKERELVFRI-------------EPGTASWYRGLPA--DV------------------------ 
61 psef5-q4kaz4      10.7%  -SCAV-------------------------------------------------LEHKERQLVFRI-------------EPGTAGWYRGLPS--TV------------------------ 
62 psepf-q3kew2      12.3%  -SCAV-------------------------------------------------LEHTERKLLFRI-------------EPGTAGWYHGLPG--SV------------------------ 
63 psepu-a1fc94      10.6%  -GCTV-------------------------------------------------LQHKERELVFRI-------------EPGQASWFRGLPS--GV------------------------ 
64 borpe-q7vsl4      13.6%  -GFNQ-------------------------------------------------LDAWQRQAIFSP-------------QTDQQRWWREPPAGTEV------------------------ 
65 chrvo-q7nww4      10.4%  -GMFF-------------------------------------------------FDHWQRLKIF---------------EPAHQLYPTPDEMGVPY------------------------ 
66 synp6-q5n0k4      13.0%  -FLAA-------------------------------------------------IWLGQSRLIFRP----------AKDEPIPESLLAYQPA---------------------------- 
67 lepin-LA3770      10.1%  -GCFV-----------------------------------------------------SRKLIFIAQG--------KDTLPS-------------------------------------- 
68 cupnh-q0k226       7.5%  ------------------------------------------------------AAGVARHLLFRAVE------RKAFVTPTDETKDAAAPD---------------------------- 
69 cupnh-q0jzs8       9.4%  -ACYW-------------TY----------------------------------LTLNQERLLFDA----------RRRPPRD------------------------------------- 
70 ralme-q1lg65       9.4%  -VCYW-------------TY----------------------------------LTINQERLLFDA----------RRRPPRD------------------------------------- 
71 phopr-Q93CF7      10.5%  -FCLL-------------------------------------------------LFVLQRKFIYFP-------------QPSA------------------------------------- 
72 mimiv-yr595       10.6%  ------------------------------------------------------LIYLKNFILYQP----------HKDHPVK------------------------------------- 
73 enccu-ECU09.0730   7.5%  DFLFL-------------------------------------------------LFTIQRSLYFFGKG--------MRRKPEN------------------------------------- 
74 dicdi-q54f01      10.2%  ------------------------------------------------------------------------------------------------------------------------ 
75 plafa-MAL7P1.156   9.0%  ---------------------------------------------------------LSNSTLF---------------RPTEPSYDDELKNLVYIPEL--------------------- 
76 thean-q4ue56       7.9%  ------------------------------------------------------AKSIANSIIF---------------PAPQASYDHNLPELVWIPKN--------------------- 
77 thepa-q4n5d6       6.3%  ------------------------------------------------------AKSIANSIIF---------------PAPQASYDHNLPELVWVPKN--------------------- 
78 butfi-CINII       12.5%  -ACGT-------------------------------------------------SSNSSKEIVMKS------------------------------------------------------ 
   consensus/100%           ........................................................................................................................ 
   consensus/90%            ........................................................................................................................ 
   consensus/80%            ........................................................................................................................ 
   consensus/70%            ........................................................................................................................ 

 1 9bact-3WYDseq    100.0%  ----------------------------------------------------------------------SGLVPRGSHMPYRLYVPTTYDG---------TKAFPLVIALHGMGGDENS 
 2 solue-Q029Y4      56.6%  ------------------------------------------------KHGDSHRA---------Y-----RSAVDNTLQPYRLFIPETYDG---------SKPTPLVVALHGMGGDENS 
 3 9bact-b8y567      28.8%  ----------------------------------------------D-DPRVQHRS---------Y----KFGQSDDEEIPYALFVPSTYDK---------DQSAPILVSLHGLGRTYDW 
 4 9bact-b8y568      26.0%  ----------------------------------------------T-QDRIETRT---------Y-----DFKEAGKDVEYTLFVPTSYDT---------AKPTPLIVLLHGLGSNPRQ 
 5 9zzzz-EH82        33.5%  -----------------------------------------------------------------Y-----VFADTGERIPYGVFVSSSVTM---------ERKAPLVVALHGLGASQES 
 6 9bact-estC55.241  27.2%  ----------------------------------------------L-PAGPQVLT---------F-----FSDVDDTEQPYALYLPPNYDP---------SKRYPLVVSLHGAGSNHRL 
 7 9bact-estC55.165  24.1%  ----------------------------------------------D-CSCTTQTG---------F--LLRTLEYNGQTHHYQVFVPPDYTP---------ERTWPVILFLHGAGERGTD 
 8 9bact-estC76.137  25.2%  ----------------------------------------------D-SDGTMQTG---------F--LLRTLEYNGQTHRYQVFVPPDYTP---------ERTWPVILFLHGAGERGTD 
 9 9zzzz-t1ci96      20.5%  ----------------------------------------------V-VELTAHSE---------F--VERSLVHDGELVRYRIHAPRQGVT-----------TRPVLLFLHGSGERGMD 
10 xanax-XAC2981     20.6%  -------------------------------------------MTER-HHDERRGH---------F--VTRTLKLEGRLYRYQVFVPASKVP----------QPRPIVLFLHGSGERGDN 
11 xanor-q5h3e2      20.6%  -------------------------------------------MAGR-RHNERRGH---------F--VTRTLKLEGRLYRYQVFVPASKVP----------QPRPIVLFLHGSGERGDN 
12 xanca-XCC2811     20.3%  -------------------------------------------LVDR-HQDTRRGH---------F--VTRSLEIEGRHYQYQVFVPVGTSP----------QPRPIVLFLHGSGERGDN 
13 rhoba-q7ule9      21.1%  -------------------------------------------QIQV-EPGQQSEN---------FFVIPEPAEGRPEKLPFLLYTPSNYQA---------GQKVPMLLFLHGLGESGDG 
14 rhofd-q21zf7      24.9%  ----------------------------------------------L-AEGQHPQS---------L----EKQMSDTVGTPFLLYLPEGYNK-------IDGKKWPLIVFLHGSGERGDD 
15 symth-q67nt3      26.0%  ---------------------------------------------RV-EPMQESRW---------F----ARTVQKQVCANYLLFLPPGYGD-------DRSRRWPLILFLHGAGERGSD 
16 rhime-RB0531      24.8%  ----------------------------------------------E-AANAEQVA---------L----TSTVSVKNELKYLLYTPDGYAT--------STESYPLVIWLHGGDQGGSD 
17 flaj1-a5fe33      21.2%  ----------------------------------------------G-QTETTGKI--------------NTVIMSKYELGYVLHKPANT-----------KEKKPLIVFISGDGEKGTD 
18 bacfr-q64n33      25.1%  ----------------------------------------------S-QEMYQKKV---------F------ISSRGDSLNYRLLRPEVEKT---------GLQYPLVLFLHGAGERGSD 
19 bactn-BT3286      23.0%  ----------------------------------------------A-QQGYEKDV---------F------VSSTGDSLPYRMIRPESMKA---------GKKYPLVLFLHGAGERGND 
20 bacsk-q5wbk1      25.9%  ----------------------------------------------V-VESFSYES---------Y------QNQAGATLPYRLYEPNQEE----------GERYPLVLFLHGGGERGND 
21 thema-TM0033      17.2%  YVVLELSTEDLHSNTIVFGPNFLNTRMKLDYIVSQLVPIFDVDGNEV-EPFTSKQTDEKHLIIDDFLAFTFKDPETGVEIPYRLFVPKDVNP---------DRKYPLVVFLHGAGERGTD 
22 anavt-q3m5j3      23.3%  ---------------------------------------------------IERRS---------------------GLLPY-LFSRAAEET---------NKPAPLVLFLHGARDRGTD 
23 nosco-q3i1p4      24.2%  ---------------------------------------------------VEQRS----------------HDTNNGSLPY-LFSPVSDNA---------KQPAPLVIFLHGGRDRGTD 
24 actsz-a6vkk1      19.6%  ---------------------------------------------WL-DEFTAKSV---------F------LTDKANFLNYRIFTPHFEQ----------GKAYPLTIFLHGSGQVGSD 
25 pasmu-PM1358      17.5%  -----------------------------------------------------HRV---------W------HTQQDNQLLYRFYQPAIDS----------GKKYPLTLFLHGSGQVGKD 
26 myxxd-q1cxe9      16.4%  ----------------------------------------------T-GRGTTQEV---------Y-----KSPSTPGGYGYVVYLPPGYDE---------GSNWPVVFFLHGMGEQGDG 
27 stiad-q09av6      15.4%  ----------------------------------------------T-GRGTTTEV---------Y-----KSAATPGNYGYVVYLPPGYTE---------GSNWPVVFFLHGMGQRGNG 
28 halo1-d0lmj0      15.9%  ----------------------------------------------S-SARLSVRA----------------LDTTEAGNGFWEYLPPRYG----------AEPAPLMVFWHGIGENGDG 
29 stiad-q09db1      16.5%  --------------------------------------------------------------------VARLPASTGALYGYGEYLPPGYLT--------STASYPVILHLNGMGEFGTS 
30 mycua-a0pqs2      25.4%  ----------------------------------------------------------------------------GRVQPYSVCLPSTYAP---------GRAMPLTLLLHSLALGQNQ 
31 braja-BLL1350     14.0%  ----------------------------------------------L-LARLEAGAGE-HGGI--F----HDHNEPGSRGGFSVYVPEYYSP---------ERAMPLVMALHGGSGNGRG 
32 rhopa-q6ncc5      16.3%  ----------------------------------------------L-LARLTQPKHP-DSGV--F----HRFNEPGSRSGYSLYVPEYYDP---------DREWPLVMALHGGSGHGRL 
33 rhopa-q37hi0      14.7%  ----------------------------------------------L-HARLAQPKHP-DSGV--F----HYANEPGSRGGFSFYVPEYYTP---------DRAWPLVVALHGGSGNGRL 
34 pseal-PHAZ        16.1%  -----------------------------------------------------------------YQST-WLDSGLVGQRKIIYQTPLGTPP---------AGGWPVVLVYQGSFFPLND 
35 psefl-phaz        16.1%  -----------------------------------------------------------------YQST-WLDSGLVGQRKIIYQTPLGTPP---------AGGWPVVLIYQGSFFPLND 
36 psepa-q6vqy9      12.8%  -----------------------------------------------------------------YDNP-------------------------------DIPSGRDIVYLHGRGSTERE 
37 bacha-BH2917      11.5%  ---------------------------------------------------VTNET---------IASI------------PALHVVQEELR---------HEPLPTVFFLHGFTSAKEH 
38 bacsu-YITV        13.8%  ---------------------------------------------------IENQT---------VSGI------------PFLHIVKEENR---------HRAVPLVIFIHGFTSAKEH 
39 lisin-LIN2363     12.6%  ---------------------------------------------------VENEL---------IAGI------------PVLHISNRENA---------EKELPTIIFYHGFTSQKEL 
40 lismo-LMO2262     12.6%  ---------------------------------------------------VENEQ---------IAGI------------PVLHISNSENA---------DKMLPTIIFYHGFTSQKEL 
41 oceih-OB1195      13.9%  ---------------------------------------------------IYEEQ---------VNQI------------PYLHIVKSENY---------NIELPTIIYFHGFTSAKEQ 
42 ecoli-yjfp        13.8%  ---------------------------------------------------IESRE---------LADI------------PVLHAYPVGQK---------DTPLPCVIFYHGFTSSSLV 
43 shifl-YJFP        13.8%  ---------------------------------------------------IESRE---------LADI------------PVLHAYPVGQK---------DTPLPCVIFYHGFTSSSLV 
44 salty-YJFP        12.3%  ---------------------------------------------------IETRQ---------LAGG------------VVLHAFPEGKR---------AVPLPCVVFYHGFTSSSLV 
45 entcc-a0a0h3cfu5  13.8%  ---------------------------------------------------IETRR---------LGNH------------EILHAIPAGKS---------AHPLPVVVFYHGFTSSKLV 
46 entcl-a0a157v5g4  13.2%  ---------------------------------------------------LEMRN---------LAGG------------EVIHACPAGMA---------EKPLPVIVFYHGFTSSKLV 
47 erwct-q6d134      14.9%  ---------------------------------------------------MSLDK---------LGSG-----------IEAIHAAPLGRR---------EQPLPTIFFFHGYMSSKEV 
48 yerpe-Y0644       14.6%  ---------------------------------------------------------------------------------MWITIAPF-------------VTLPTIFFYHGYTSSKEV 
49 entfa-EF2792      13.4%  ---------------------------------------------------IRHRY---------IAKI------------PALEVTTEEQK---------NEALPLIVYYHGWQSAKEL 
50 lacss-q38vr0      13.1%  ---------------------------------------------------VLKRQ---------IKGI------------PVLEVVAENAR---------HEPLPLVVYYHGWRSAKEL 
51 lacpl-LP.1760     15.2%  ---------------------------------------------------VTNRH---------FQDV------------PALEVVTTTHL---------DQPLPLVIFYHGWQSNKEL 
52 entfc-q3xxj0      12.4%  ---------------------------------------------------ILKRS---------VHHI------------PVLEVVLKELR---------EERIPVVIYYHGWQTSKEL 
53 lacpl-LP.2631     12.5%  ---------------------------------------------------VRTTK---------FGDL------------PVLHVFAASQA---------QTKLPTIIDYHGWTNQTAT 
54 aciac-a1tlq0      11.9%  --------------------------------------------QDV-WIAFDSRA------------------TGKAEKLHGLWMPSDR------------ADAPVLLYLHGARWNVSG 
55 polna-a1vle4      11.5%  --------------------------------------------QNV-WIGFDSTT------------------TGRPVKLHGLWLPADKQQ-----TGWNGAKAPLLLYLHGARWNVEG 
56 polsj-q128b8      11.6%  --------------------------------------------EDV-WIKFNSRI------------------NDQNIRLHGLWLPADTDR-----DRPQAGKAPVMLYLHGARYNVTG 
57 comte-a0hgv8      12.0%  --------------------------------------------QEQ-WIDFRSR-------------------DGSAARLHALWMPSGN------------ARAPLLLFLHGARWNVTG 
58 pse14-q48gq9      13.4%  --------------------------------------------QEI---ELSTPS------------------FGPSQNIHAWWWPASD------------KNAPAVLYLHGSRWNLTG 
59 pseu2-q4zr46      13.6%  --------------------------------------------QEI---ELSTPA------------------FGTSQNIHAWWWPAAD------------KNAPAVLYLHGSRWNLTG 
60 psesy-PSPTO3572   12.9%  --------------------------------------------QEI---ELRTPA------------------FGTSQNIHAWWWAAPD------------KNAPAILYLHGSRWNLTG 
61 psef5-q4kaz4      10.7%  --------------------------------------------QEF---ELKPKS------------------FKAGQNIHAWWWPAQR------------ADAPAILYLHGVRWNLTG 
62 psepf-q3kew2      12.3%  --------------------------------------------QEL---DLQPKS------------------FKAGQNIHAWWWPAER------------ADAPAILYLHGVRWNLTG 
63 psepu-a1fc94      10.6%  --------------------------------------------QEL---DLRPRS------------------FAANQSLHAWWWPARR------------ADAPAILYLHGVRWNLTG 
64 borpe-q7vsl4      13.6%  --------------------------------------------FDLA--------------------------LPNGDKVHAWYWQSPR------------RDAPTVLYLHGARWNLNG 
65 chrvo-q7nww4      10.4%  --------------------------------------------KDI-WLTIRNME------------------NEDKGILHGWWLPNKE---------------ASMLYLHGSESTIAT 
66 synp6-q5n0k4      13.0%  ---------------------------------------------EV-WIALQPQAV-------------------RSPRLQAWWFPNQ------------GVTPWTVLYLHGIQGRWVD 
67 lepin-LA3770      10.1%  -----------------------------------------------------------------YSGT-LLQIQNEDRIVYAYFT---------------RNSSRLAVVFHGQHGTLQS 
68 cupnh-q0k226       7.5%  ---------------------------------------------IS-ALTVRHAT---------F--------ASGNRILHAAFMPAA------------DPEAPALMVCHGDNESLPD 
69 cupnh-q0jzs8       9.4%  --------------------------------------------------------------------------LPDGIIGYSHLIPGGVVRGY-IYHSPGDNVRDLLFYLPGRGEDVLE 
70 ralme-q1lg65       9.4%  --------------------------------------------------------------------------LPDGIVGYSHAVPGGQFRGY-CYHADHEGVGDLLFYLPGRGEDVLE 
71 phopr-Q93CF7      10.5%  ----------------------------------------------A-VRGITEIS---------F--------TTDGVQLSGWVV--------------NEGQPKALIYYGGNAERIEN 
72 mimiv-yr595       10.6%  -------------------------------------------------------------YCKFFHKL---SKLTEPENIHHLYLKTPDNILLDTIVIRNTDTNKCIIYFHGNAGNIAM 
73 enccu-ECU09.0730   7.5%  ---------------------------------------------------IRVRL------------------VSRGQSEVDLYL-------------IDQMSSTDIIYLPGNFVVTRE 
74 dicdi-q54f01      10.2%  -------------------------------------------------------------------------------------------------------SKLTILYSGGNLEDIGL 
75 plafa-MAL7P1.156   9.0%  -------------------------------------------------MNIDVNKFWNDKTYEIFNKE-ENIKELHNKKFPALFLYYTKD----------VKTKHTIMYFHSNSCDLGQ 
76 thean-q4ue56       7.9%  -----------------------------------------------------------------FASKDLNIDKPSSRSFPVLFIRSI------------KPSSLFFIYLHG------L 
77 thepa-q4n5d6       6.3%  -----------------------------------------------------------------FASKDLNIDKPSSRSFPVLFIRSP------------QPSSLFFIYLHANCCDIGL 
78 butfi-CINII       12.5%  ------------------------------------------------DYTVNTEV--------------VEIPSGDNTLYGTLYTPET------------DSKTPLIIMCHGYNGVGDD 
   consensus/100%           ...........................................................................................................hh...u....... 
   consensus/90%            ...................................................................................h.h....................hhhhhpG.t..... 
   consensus/80%            ...................................................................................hah................t.hPhllhhHG.t.pht. 
   consensus/70%            ....................................................t............................hhlahsst............ttthPhllahHGhttphpt 

 1 9bact-3WYDseq    100.0%  YFDSY-----------QRGAFM----------IEAEN-RGYIVACPKGRQP-----------------ASMYV----------------------------GPAERDVMDVIAEVRRDY- 
 2 solue-Q029Y4      56.6%  MFDSY-----------ANGLLK----------REAER-LGFMVVCPKGRDS-----------------ASMYR----------------------------GSAEQDVLDVLAEVRRNY- 
 3 9bact-b8y567      28.8%  LMGYE-------------GML-----------EFAER-DGFIVVAPLGYVR-----------------RGWYGSYRARVGEEI-----------------AERSEADVMNVLGLVREEY- 
 4 9bact-b8y568      26.0%  VIRYQ-------------GIA-----------EGAEE-YGYIVVAPFGYNE-----------------RGWYGSLGQDNQFARRFRRNQNAPFNEPE-NLGELSEKDVFNVLALIREEF- 
 5 9zzzz-EH82        33.5%  MVRTSF---------------RAV--------ELAEK-GGYILVVPLGYNS-----------------SGWYGVQAGGSVQQQ-----------------REYSEKDVMNVLAMVRDEF- 
 6 9bact-estC55.241  27.2%  NLRRVF---------GKHNLPGESDVEATRYFPEWRD-VDYIVISPFARGT-----------------MGYQG-----------------------------IAEKDVYDAIEDVKRRF- 
 7 9bact-estC55.165  24.1%  GFKPT-----------AVGIGQAIR-------MNVER-FPAIVVFPQVPPG-----------------RAWFG-----------------------------EQAEVAMAALDEVMATY- 
 8 9bact-estC76.137  25.2%  GFKQT-----------AVGIGQAIR-------MNVER-FPAIVVFPQVPPG-----------------RAWFG-----------------------------EQAEVAMAALDEVMATY- 
 9 9zzzz-t1ci96      20.5%  NIAQT-----------RVGLGPALL-------RGAVP-LPLLAVFPQLPPG-----------------ASWQG-----------------------------VHAGRALAVLEDACAHC- 
10 xanax-XAC2981     20.6%  GRDQA-----------EVGVGPYLS-------EHTAD-FPALVVLPQVPED-----------------EEWMG-----------------------------INARMAIAALDAASAEF- 
11 xanor-q5h3e2      20.6%  GRDQA-----------EVGVGPYLS-------QHTAD-FPALVVLPQVPDD-----------------EEWLG-----------------------------VNARMAIATLDAASAEF- 
12 xanca-XCC2811     20.3%  GRNQA-----------EVGVGPYLS-------EHTAD-FPALVVLPQVPDD-----------------EEWLG-----------------------------INARMAIAALDATSAEF- 
13 rhoba-q7ule9      21.1%  NFKQL----------AVHGPPKRVA-------KEGKE-FPFVIVSPQSPKPGKD---------RADVVESW--------------------------------KVDELMALLDHVEEHL- 
14 rhofd-q21zf7      24.9%  IEKVK-----------AHGPPKML--------ETQKD-FPFIVVSPQAAAH-----------------TNW--------------------------------NSNSLTVLLDEVIARL- 
15 symth-q67nt3      26.0%  LSLVK-----------RHGLPKLLD-------ERPGD-FPFIVVSPQCPDG-----------------EVW--------------------------------DVDVLLALLDEVCETH- 
16 rhime-RB0531      24.8%  IDKVK-----------SSGIPKLI--------EDGKK-FPFLVFSPQNPSE-----------------ELLYP-------------------------------IEKVDAALEEVASTY- 
17 flaj1-a5fe33      21.2%  LEKVK-----------VHGPLKYLK---------THQ-LDAYVLAPQCKED-----------------ENW--------------------------------DIESIYQLILKIQKEN- 
18 bacfr-q64n33      25.1%  NEKQL-----------THGGQMFLNP------VNREK-YPAFVLVPQCPEK-----------------DYWAY--TSRPSSFI--------PSEMPVGQEITPVLRAVKELLDTYLDLP- 
19 bactn-BT3286      23.0%  NERQL-----------THGGQMFLNP------VNREK-YPAFVLVPQCPAG-----------------SYWAY--TERPKSLF--------PADMPAGQEMSSLTRTLKQLLDTYLAMP- 
20 bacsk-q5wbk1      25.9%  NQIHLL---------GSEGGVAFARP------DVQEQ-HPSFVVAPQAPYD-----------PSVPLLEGWTT----------------------------EPTYSMVLELVELMKERY- 
21 thema-TM0033      17.2%  NYLQVA---------GNRGAVVWAQP------RYQVV-HPCFVLAPQCPPN-----------------SSWSTLFTDRENPFN-----------------PEKPLLAVIKIIRKLLDEY- 
22 anavt-q3m5j3      23.3%  INVLL-----------KWGLPRFV--------DESSP-LPYFFVAPQLPEG-----------------QTWVD------------------------------READVIALLDNLIVSQ- 
23 nosco-q3i1p4      24.2%  LNVLL-----------KWGLPRFV--------DLSDS-LPYVFAAPQIPAE-----------------QTWAD------------------------------RADDVLTLLDELIVSQ- 
24 actsz-a6vkk1      19.6%  NLAHLL---------SGKGAISTLQY------------ERGIVLAPQYQSVFDP-FDD--SAKGQNGGIHWQT----------------------------DNRRDLVFNMIDDTLAQY- 
25 pasmu-PM1358      17.5%  NLAHLL---------SSKGAIATLLY------------EDGFVLAPQYDAVFDA-FDK--T------GIHWQT----------------------------DNRHQLLFKLLDDVIASH- 
26 myxxd-q1cxe9      16.4%  GVNQL-------KKVRAHGPQAYID-------QEGKD-YPFILVSPQTSTS-----------------GFWSA----------------------------YEAQYNLDPFFEHILATF- 
27 stiad-q09av6      15.4%  GATEL-------KRVRELGPQRYID-------QQGKD-YPFVLVSPQTGPS-----------------GTWSP----------------------------YEAEYNLNPFVNHILATY- 
28 halo1-d0lmj0      15.9%  SEAAL-------DKVLANGPPRYIERD-----EWSNE-RPFVVLSPQHAGGGCP-------------------------------------------------SADEIRDFLAFAVDTY- 
29 stiad-q09db1      16.5%  PTEADLL-----NVVTRHGALKRIRNTAQG-KAYFGQ-HQVMVFTPRAATN-------------------W--------------------------------VPAEVNAFVDFLIAHY- 
30 mycua-a0pqs2      25.4%  FASID---------------PRLLH-------EVCET-RGSVVVTPLARGP-----------------STWYF----------------------------GAGELDAWEVWARVAEQL- 
31 braja-BLL1350     14.0%  FLWSWL--------------------------RDARS-VGAILVAPTATGQ------------------TWAL-------------------------MGDDTDTPNLMRILETVRSRW- 
32 rhopa-q6ncc5      16.3%  FLWSWL--------------------------RDARA-RGAIVVAPTATGR------------------TWAL-------------------------MGEDVDSPNLARILDEVRGHW- 
33 rhopa-q37hi0      14.7%  FLWNWL--------------------------RDARS-RGAIVVAPTATGR------------------TWAL-------------------------MGDDADTPNLARIVDFIRSRW- 
34 pseal-PHAZ        16.1%  FSYHGNLPFGG----YYEGKL----------VQALLD-NGYAVIAPSAPAD-----------------LFWQTNIPGLAQAYE-----------------LSTDYDFLGNVLAAIASGHF 
35 psefl-phaz        16.1%  FSYHSNLPFGG----YYEGKL----------VQNLLD-HGYAVIAPSAPAD-----------------LFWQTNIPGLAQAYE-----------------LSTDYDFLGNVLAAIASGHF 
36 psepa-q6vqy9      12.8%  AGFALPL-FGRANVRSYRGPLPQGPGF-----AWFEN-AGIGVALPSS------------LSGETSKVGDWIA----------------------------------------------- 
37 bacha-BH2917      11.5%  NLHHA---------------------------YLLAQ-KRIRVILPEALYHGER-AAF--EDEQKLQLSFWEI---------------------------VLRSIEELPQMKHFVVENG- 
38 bacsu-YITV        13.8%  NLHIA---------------------------YLLAE-KGFRAVLPEALHHGER-GEE--MAVEELAGHFWDI---------------------------VLNEIEEIGVLKNHFEKEG- 
39 lisin-LIN2363     12.6%  YLHYG---------------------------YLLAQ-RGFRVVLPDAKLHGER-LQG--ANPEDQATYFWDV---------------------------IETNITEFPLITEELIKTG- 
40 lismo-LMO2262     12.6%  YLHYG---------------------------YLLAQ-RGFRVILPDAKLHGER-LQG--ANPEDQATFFWDV---------------------------IETNITEFPLITDELIKAG- 
41 oceih-OB1195      13.9%  NLPIA---------------------------YMLAQ-KGFRVLLPESLYHGER-SNG--LTDKQLQMSFWNI---------------------------VIQNVQDLEELRSVLLENN- 
42 ecoli-yjfp        13.8%  YSYFA---------------------------VALAQ-AGLRVIMPDAPDHGSR-FSG--DAARRL-NQFWQI---------------------------LLQSMQEFTTLRAAIAEEN- 
43 shifl-YJFP        13.8%  YSYFA---------------------------VALAQ-AGLRVIMPDAPDHGSR-FSG--DEARRL-NQFWQI---------------------------LLQSMQEFTTLRAAIAEEN- 
44 salty-YJFP        12.3%  YSYFA---------------------------VALAQ-AGFRVVMPDAPEHGAR-FGG--DSQGRI-HRFWQI---------------------------LHQNMQEFTTLRAAIQAEN- 
45 entcc-a0a0h3cfu5  13.8%  YSYFA---------------------------VALAQ-AGFRVVMPDAPDHGAR-FTG--DEQVRL-GQFWQI---------------------------LHGSLSEFAGLRDALYQAG- 
46 entcl-a0a157v5g4  13.2%  YSYFA---------------------------VALAE-AGFRVIMPDAAEHGAR-FHG--DDAGRM-LRFWPI---------------------------LRQNFVEFAALREAIIAEG- 
47 erwct-q6d134      14.9%  YSYFG---------------------------YALAQ-AGFRVILTDAAMHGAR-YNG--DDAHRL-GHFWDV---------------------------LQSNIEELPDYVAEYRQRG- 
48 yerpe-Y0644       14.6%  YSYFA---------------------------YAFAQ-AGFRTISPDADMHGAR-FNG--NETQRL-SHFWEI---------------------------LKSNIDELPDLKRHYQQAG- 
49 entfa-EF2792      13.4%  SLTQA---------------------------RKLAH-EGFRVILPDAMNHGERKTEP--ISTIPS-ITFWSS---------------------------IQYNLIEFPVIIHHFHKLG- 
50 lacss-q38vr0      13.1%  VLTQA---------------------------RKLAQ-AGMRVVLPDALNHGER-LQP--VSEIPS-WTFWQS---------------------------IQTNLAEFSLIIDYWQQLH- 
51 lacpl-LP.1760     15.2%  VLTQA---------------------------RKLAR-KNLRVVLPDAMNHGER-HQI--VSQIPS-FTFWNS---------------------------IQGNLGEFELIVNYYRERK- 
52 entfc-q3xxj0      12.4%  VLTQG---------------------------RKIAQ-QGIRVILPDAMNHGER-KQP--VSSIPS-YTFWDS---------------------------IYGNLFEFDTLIKHLEKRG- 
53 lacpl-LP.2631     12.5%  ELGTA---------------------------YQLVR-AGFRVILPTAYLHGSR-NDG--TDLDRHPEHFWSI---------------------------VGHSVAEFPQLVAALVAAG- 
54 aciac-a1tlq0      11.9%  SAGRI---------------------------RRMND-MGFSVLAVDYRGFGRS-SPA--LPSEATAL-------------------------------------EDARAAWDWLAARE- 
55 polna-a1vle4      11.5%  SAPRI---------------------------RRMQE-LGFSVLAVDYRGFGKS-SPD--LPSENMAY-------------------------------------EDAQAAWRWLAAHH- 
56 polsj-q128b8      11.6%  SAPRM---------------------------RRMQE-LGFSVLAIDYRGFGKS-THE--LPSEASAY-------------------------------------EDARVAWDWLAQKY- 
57 comte-a0hgv8      12.0%  SSPRI---------------------------RRLQA-MGFSVLAVDYRGFGKS-SPA--LPSQASAA-------------------------------------EDARAAWEWLGRQA- 
58 pse14-q48gq9      13.4%  QLFRI---------------------------QQLKA-QGYSILAIDYRGFGQS-MGQ--LPSEKSVY-------------------------------------EDARIAWARLKQL-- 
59 pseu2-q4zr46      13.6%  QLFRI---------------------------QQLKA-QGYSILAIDYRGFGQS-MGQ--LPSERSVY-------------------------------------EDARIAWERLKQL-- 
60 psesy-PSPTO3572   12.9%  QLFRI---------------------------QQLKA-QGYSILAIDYRGFGQS-MGQ--LPSEKSVY-------------------------------------EDARIAWQRLKQL-- 
61 psef5-q4kaz4      10.7%  QLFRI---------------------------EQLHA-LGYSVLAIDYRGFGQS-HGD--LPSESSVY-------------------------------------EDARIAWERLKVL-- 
62 psepf-q3kew2      12.3%  QLFRI---------------------------EQLRA-AGYSVLAIDYRGFGQS-RGD--LPSESTVY-------------------------------------EDARVAWERFQLL-- 
63 psepu-a1fc94      10.6%  QLFRI---------------------------EQLHA-MGYSVLAVDYRGFGQS-RGG--LPSEATVY-------------------------------------EDARIAWERFAQL-- 
64 borpe-q7vsl4      13.6%  SAFRM---------------------------EGWTR-MGYSMLAIDYRGFGQS-TPL--LPSEQSAS-------------------------------------QDAAAALQELARR-- 
65 chrvo-q7nww4      10.4%  DLDKI---------------------------LQIWN-AGYSVLAIDYRGFGQS-TKM--LPNENSVT-------------------------------------EDAMAAWDYLKTL-- 
66 synp6-q5n0k4      13.0%  TEDRL---------------------------LQLLS-LGLSVLVLQYRGYGRS-SGP--FPNEQRVC-------------------------------------ADAEAAVAYLAKEH- 
67 lepin-LA3770      10.1%  MSYLG---------------------------AKLSQ-MGFSVLLVEYPGYGKA-KRY--SSSESNIY-------------------------------------SDADAAINFVQKNF- 
68 cupnh-q0k226       7.5%  WAPVQ---------------------------AMLAG-AGIASYVFDYSGYGRS-SG---RPSVRRLR-------------------------------------EDALAAYRQFLAA-- 
69 cupnh-q0jzs8       9.4%  TLQYA---------------------------RWLPA--GMAFATYDYRGLGHS-DG---LPSEGAAV-------------------------------------ADASQFLLHARR--- 
70 ralme-q1lg65       9.4%  TLQFV---------------------------KWLPH--GMGFATFDYRGIGHS-DG---MPSEAAAV-------------------------------------ADASQFLLHLRR--- 
71 phopr-Q93CF7      10.5%  NIAFFE--------------------------AVLSN---YSVYLIPYRGYGNS-TG---TPSEAYLY-------------------------------------HDALYIFDRV----- 
72 mimiv-yr595       10.6%  RYNII---------------------------KFLFN--YASVIVFDYRSFGRS-TGSFITMNQQDLS-------------------------------------TDAETIWNYVIKNL- 
73 enccu-ECU09.0730   7.5%  HIEFC---------------------------KYLSKALRCNTVSMIYRGIAGN-PH---VPSERGIV-------------------------------------EDVSTASEWL----- 
74 dicdi-q54f01      10.2%  TRKYM---------------------------KILSNILQVNIFCYDSTGYGLN-AG---KPSLKESL-------------------------------------EDIFIIFNYLTNSL- 
75 plafa-MAL7P1.156   9.0%  IYDEL---------------------------NHLHEHLHANILAIEYIGFGLC-YLE-GSTNQYNIN-------------------------------------RRALAAYNFLKSL-- 
76 thean-q4ue56       7.9%  IKPEL---------------------------YDISEALGASIVAVEYPGYGIS-PEI-QVTTGPSVN-------------------------------------LRVIATFHFLLSL-- 
77 thepa-q4n5d6       6.3%  IKPEL---------------------------YDISEAIGASIVAVEYPGYGLS-PEI-SVTTGPSVN-------------------------------------LRVIATFHFLLSL-- 
78 butfi-CINII       12.5%  FQEEG---------------------------KYFAQ-NGIATYTLDFCGGSTR-SKS--TGETKDMT--------------------------------IFTEKADLLNAYNYFKTQD- 
   consensus/100%           ...........................................h............................................................................ 
   consensus/90%            ....h...............................t...h.hh..ph...........................................................h..hht.h.t... 
   consensus/80%            ....h.............................htp.hsh.llh.ph.t.......................................................tph..hht.hht... 
   consensus/70%            .hh.h.............................htp.hshhVlhsph.sh......................................................tchhthhphlhtt.. 

 1 9bact-3WYDseq    100.0%  -KIDPDRIYMTGHSMGGYGTWSIAMNHPDV------------------------FAALAPVAGGGN-----------------------------------------------PLGMANI 
 2 solue-Q029Y4      56.6%  -RVDAARIYLMGHSMGAYGTWSTAMDHPDI------------------------FAALGPISGGGS-----------------------------------------------AAGMVKI 
 3 9bact-b8y567      28.8%  -NIDPARIYLWGHSMGGAGTYHLGTKHPNL------------------------WAGLCVVAPAPLQE---------------------------------------------IAALEKI 
 4 9bact-b8y568      26.0%  -TIDKDRIYLMGHSMGGGGTLYLGMKRADL------------------------WAGLAPMAPAIYSS---------------------------------------------PDQLEPV 
 5 9zzzz-EH82        33.5%  -NIDDDRIFLMGHSMGGAGTLHLGMKYPSI------------------------WAALAPIAPATAALD--------------------------------------------PDSLASI 
 6 9bact-estC55.241  27.2%  -SIDEDRIYLTGLSMGGGGTLWLGLTRPDI------------------------WAAIAPVCPAPPQGT--------------------------------------------EALAGNA 
 7 9bact-estC55.165  24.1%  -SVDPERVYLTGLSMGGHGTWYVAYHWPDR------------------------FAAIVPICGFIVFPEAARG-----------FFGELPPEQ-----LEIQLA-----EDPYRKVAERI 
 8 9bact-estC76.137  25.2%  -SVDPERVYLTGLSMGGHGTWYVAYHWPDR------------------------FAAIVPICGFIVFPEAARG-----------FFGELPPEQ-----LEIQLA-----EDPYRKVAERI 
 9 9zzzz-t1ci96      20.5%  -GGDGTRVALSGLSRGGYGVWELALLQPAR------------------------YRALIPICAGLTARVG--------------------SPD-----LRVAAL--DGCADPWREAARRL 
10 xanax-XAC2981     20.6%  -GADPQRTYLTGISMGGYGAWEIGLMQPQR------------------------FAAIVPICGALKAPRDER-------------------RT-----LYVSLV--AKEADPYTAAVTQL 
11 xanor-q5h3e2      20.6%  -NADPQRTYLTGISMGGYGAWEIGLMQPQR------------------------FAAIVPICGALKAPRDER-------------------RT-----LYVSLV--AKEADPYTAAVTQL 
12 xanca-XCC2811     20.3%  -SADPQHTYLTGISMGGYGAWEIGLMQPQR------------------------FAAIVPICGALKAPRDER-------------------RT-----LYVSLV--AQEADPYTAAVTRL 
13 rhoba-q7ule9      21.1%  -SIDTSRVYLSGLSMGGFGTWRLAATHPER------------------------FAAAIPICGGGK-----------------------------------------------TEWADQL 
14 rhofd-q21zf7      24.9%  -PVDVDRIYLTGLSRGGHGTWKMAADHPER------------------------FAAIAPVCGAGD-----------------------------------------------VKSACQL 
15 symth-q67nt3      26.0%  -AVDRDRIYVTGLSMGGMGTFALALAAPQR------------------------FAAAAPVCGWGNP----------------------------------------------LQVRPEH 
16 rhime-RB0531      24.8%  -RVDRSRIYVIGFSRGGFGAWALAEQFPDK------------------------FAAIVPIAGGGN-----------------------------------------------RHYLNRT 
17 flaj1-a5fe33      21.2%  -KIDSDRIYVTGLSSGGWASWNLAFAHPDL------------------------FAANVPVAGFVDLIQ--------------------------------------------LEHACEI 
18 bacfr-q64n33      25.1%  -QVDRNRIYVVGLSMGGMATYDLAVRFPDT------------------------FAAAVPICGTVN-----------------------------------------------PVRLADA 
19 bactn-BT3286      23.0%  -EVDKKRIYIVGLSMGAMGTYDLVVRYPEI------------------------FAAAVPICGSVN-----------------------------------------------PDRLPAA 
20 bacsk-q5wbk1      25.9%  -PIDPDRIYIHGMSMGGIGTWNFIETNPDL------------------------FAGAIAICGYGH-----------------------------------------------PERAEAI 
21 thema-TM0033      17.2%  -NIDENRIYITGLSMGGYGTWTAIMEFPEL------------------------FAAAIPICGGGD-----------------------------------------------VSKVERI 
22 anavt-q3m5j3      23.3%  -SIDPSRVILSGFSLGTAGAWHIAAAHPGR------------------------FAGLVAVSGRVPKTLE-------------------------------------------ANQLAAL 
23 nosco-q3i1p4      24.2%  -PVDPARVILAGFSLGSAGIWHIAALHPDR------------------------FAGLVAVSGRVPKTLA-------------------------------------------ESELAAL 
24 actsz-a6vkk1      19.6%  PQIDKNRIYLVGLSRGAEGALKLLLSRPHF------------------------FAGALLMSGREAFTHE------------------------------------WIDGNATKENISPI 
25 pasmu-PM1358      17.5%  PNIDTQRIYVIGLSRGAEGGLYLLQKRPHF------------------------FAGALLMSGREANTLE------------------------------------WIEGNASVQHLSAL 
26 myxxd-q1cxe9      16.4%  -KTDRKRVYLTGLSMGGAGTFNYASLFPSK------------------------LAAAIPVCNGGYGSS--------------------------------------------AADALKM 
27 stiad-q09av6      15.4%  -KVNPRRVYMTGLSLGGGGSFSYPMVYPSK------------------------LAGIVAVCPTSWPGN--------------------------------------------PSYANGM 
28 halo1-d0lmj0      15.9%  -EVDESRIYLTGLSCGAIGSWNYLRAHLDT----------------------TPIAAAVLIAGNGRPAF--------------------------------------------NDHGCDL 
29 stiad-q09db1      16.5%  -RVDVTRIYLTGISMGGYGSWKYAYEYGSR------------------------LAALAPMATNIGAP---------------------------------------------GPKIAQL 
30 mycua-a0pqs2      25.4%  -GTDPNRTVVSGYSMGGYGAYKLSLTYPEV------------------------FAQAVVLAGPPTCGV--RLVPNV----------DIPAD--------FNLDSPCAREGDSWELLGNA 
31 braja-BLL1350     14.0%  -SIDGSRMLLTGMSDGGTFCYVSGLDGASP------------------------FTHLAPVSATFHPLMA----------------------E--------------------MADAARL 
32 rhopa-q6ncc5      16.3%  -RIDPSRLLLTGLSDGGTFCYVSGLTSDSP------------------------FTHLAPIAASFHPLLA----------------------G--------------------AADSARL 
33 rhopa-q37hi0      14.7%  -SIDPERLLVTGLSDGGTFCYVTGLDDASP------------------------FTHLAPIAASFHPLLA----------------------G--------------------MASVDRL 
34 pseal-PHAZ        16.1%  GPLNAQRQYATGISSGGYNTSRMAVSFPGR------------------------FRALAVQSGSYATCSG--------------PLCVVPDQ---------------------------- 
35 psefl-phaz        16.1%  GPLNAQRQYATGISSGGYNTSRMAVSFPGK------------------------FRALAVQSGSYATCSG--------------PLCVVPDQ---------------------------- 
36 psepa-q6vqy9      12.8%  ADTGRQRPWLCGFSNGAAMAASLLLSNPGA------------------------YSGLIMIGGCFAVE-----------------DGDLPDN--------------------------GL 
37 bacha-BH2917      11.5%  -WTASDVIGVTGTSMGAITMFGALKKYPWI------------------------RAGASLMGSAFYQHFAKKQIEFLEERGVT-----LANE-------IKEDTLVKLKEVDLGEEIDAL 
38 bacsu-YITV        13.8%  -LIDGGRIGLAGTSMGGITTLGALTAYDWI------------------------KAGVSLMGSPNYVELFQQQIDHIQSQGIEI---DVPEE-------KVQQLMKRLELRDLSLQPEKL 
39 lisin-LIN2363     12.6%  -KTDANRIGVGGVSMGAITSLGLLGQYDYI------------------------KVAVSLMGSAYYVDFAKELSKYALAQGLT-----FPYD--------VDERILALQKYDLTQNITKI 
40 lismo-LMO2262     12.6%  -KTDANRIGVGGVSMGAITSLGLLGLYENI------------------------KVAVSLMGSAYYVDFAKELSKYALAQGLT-----FPFD--------VDERILALQKYDLTQNITKI 
41 oceih-OB1195      13.9%  -WLLEDKLGIAGTSMGGITTSAALAKYNWV------------------------RAAAIMMGSPKITDYANALIGNFKKYGEL----PISDN-------QLQQLLTEIEAMDLSRHVNTL 
42 ecoli-yjfp        13.8%  -WLLDDRLAVGGASMGAMTALGITARHPTV------------------------RCTASMMGSGYFTSLARSLFPPLIPETAA-----QQNE--------FNNIVAPLAEWEATNHLEQL 
43 shifl-YJFP        13.8%  -WLLDDRLAVGGASMGAMTALGITARHPTV------------------------KCTASMMGSGYFTSLARSLFPPLIPETAA-----QQNE--------FNKIVAPLAEWEATNHLEQL 
44 salty-YJFP        12.3%  -WLLDGRLAVGGASMGGMTALGIMTRHREV------------------------KCGASLMGSGYFTGLARTLFPPLSPQNPA-----QQAE--------FDNIIAPLREWEVTHQLERL 
45 entcc-a0a0h3cfu5  13.8%  -LVADQRLSVAGASMGGMTALGIMARHPEV------------------------TSVACLMGSGYFTSLSKTLFP--------------PQD--------ATEIDALLAEWEVTRALPRL 
46 entcl-a0a157v5g4  13.2%  -WLEDERLSVAGASMGGMTALGIMTHHPEL------------------------KCVACLMGSGYFSTLAQTLFPSPEFDT------------------------ASLAEWDVTHQLAAV 
47 erwct-q6d134      14.9%  -LIDGERVGVCGASLGGMSALGCMARYPWI------------------------TAVAAFMGSGYFSTLSSTLFPPVPADHEE-----NQAV--------LQALATKLADYDVTTRLDAL 
48 yerpe-Y0644       14.6%  -LIEGERIGVAGASMGGMTALGAFARYPWI------------------------RVAADFMGSGYFTSLAHSLFPPRDAGREI-----SQQA--------FERRLAPLADYELTHQLEKI 
49 entfa-EF2792      13.4%  -LIKENWIGVGGVSMGGITTSALMTQHPEI------------------------QAAACLMGTPYPARYIQRVIQRAKEFAIF-----VPKD--------LPLLLSWVHQYDLSQTPERL 
50 lacss-q38vr0      13.1%  -LIKDDLIGVGGVSMGGMTTAALLTKHPEI------------------------KVAACIMGSPAPLTYARLVRDNVRQHGLQ-----QPAD--------LGLLTSWLTAYDLTQQPKAL 
51 lacpl-LP.1760     15.2%  -LILNEQIGVGGYSMGGMTTGALLTHHPEI------------------------KAATIIMGTPNLNAYAQLVRKHAQAHAYY-----IPSD--------LALLTSWLDHYDLNLQPETI 
52 entfc-q3xxj0      12.4%  -LL-HDQLAVGGVSMGGMTTCALLAKHPHI------------------------VAGVCLMGSPAPLEYGKEIVRRASEYNYV-----VPKD--------YFDLISWVKSYDLSLQPEKL 
53 lacpl-LP.2631     12.5%  -ISDANKIGVMGTSMGGITAAGIMATQPTV------------------------VAGVSLIGSPEPVAFATDQVAQLPAALQA----KLPAE-------LIEQTYQQLAKFDLSEHPEAL 
54 aciac-a1tlq0      11.9%  ---PRAPRYIFGHSLGGAIAIDLAAMVPDE-------------------------QGTIVEGTFTNIP---EVVATF-------KWGWLP----------ISGL--ITQRFESVRKVAHI 
55 polna-a1vle4      11.5%  ---PGQPRYIFGHSLGGAVAIELASRVHDE-------------------------AGTIVEGTFTSIA---DVVSTM-------KWGWLP----------LSAL--ITQPFESVQKVARL 
56 polsj-q128b8      11.6%  ---PNRPRYIFGHSLGGPIAINLANEVADE-------------------------SGTIVEGTFTSIA---DVVSTS-------KWGWMP----------LSLL--ITQRFEAVHKVATI 
57 comte-a0hgv8      12.0%  ---AGRPRYVFGHSLGGAVAIDLASSVKDE-------------------------SGVLVESTFTSIP---DVFDSM-------RWGWLP----------VNWL--ITQRFNSVDRVADI 
58 pse14-q48gq9      13.4%  -QPDPQRKLIYGHSLGGAVAVDLAAELGNDAEKDNAP---------------IQARGLIIESTFTNLA---DVATAL-------ANTSLP----------VRWL--LSQKFDSLDKIADI 
59 pseu2-q4zr46      13.6%  -QPDPQRRLIYGHSLGGAVAVDLAAELGEDAEKDNAP---------------IQARGLIIESTFTNLA---DVATAL-------ANTSLP----------VRWL--LSQKFDSLDKIADI 
60 psesy-PSPTO3572   12.9%  -QPDPQRRLIYGHSLGGAVAVDLAAELGHDAEKDNAP---------------VQARGLIIESTFTNLA---DVATAL-------ANTSLP----------VRWL--LSQKFDSLDKIADI 
61 psef5-q4kaz4      10.7%  -QPDASKRLIYGHSLGGAVAIDLAAELGRQAASAKAP---------------TAARGLIVESTFTTLA---DAAAAV-------TKTSLP----------VRWV--MSQKFDSIDKIREI 
62 psepf-q3kew2      12.3%  -QPDPNKRLIYGHSLGGAVAIDLAAELGRDATRNHTP---------------LPVRGLVIESTFTSLA---DVAAAV-------ANTSLP----------VRWL--LSQKFDSIDKIAEI 
63 psepu-a1fc94      10.6%  -QPDAGKRLIFGHSLGGAVAVELAADLSRQAQKGGGT---------------APARGLILESTFTSLG---DVAAAV-------ADTTLP----------VRWL--LSQKFDSLDKIKDV 
64 borpe-q7vsl4      13.6%  -QPDPARRFIYGHSLGGAIAIDLAAR-PDLP----------------------PFAGLIVESSFTSIG---AMLGTM-------KWGWVPG---------ATLL--VTQPFASVDKLAAL 
65 chrvo-q7nww4      10.4%  -SDSKNFHGIYGHSLGSAIAINIGKRHPE-------------------------VDYLVLEGSFSSMA---DIIKETT------PYRWLP-----------SLL--LTQKFESMKNIQGI 
66 synp6-q5n0k4      13.0%  -AIPSDRLLVYGHSLGGAIAAELANRQPK-------------------------LAGLILEGSFSSMR---AMTQYRQ------RFAWFP-----------NWL--LHQRFDTLAKVRQS 
67 lepin-LA3770      10.1%  -SFSKQNTIAIGYSLGTGVAVEMARK--------------------------NLVSKMILFAPYTSIP---DVASYR-------YVPILP-----------QIL--IWDRFNSISKSKDL 
68 cupnh-q0k226       7.5%  -TPQAKRRVVLGHSLGSGILLEVAQRFDPQ------------------------PDGYVIAAGFSSARLA------------AVQTGRIP--------AWAAWL--LPDPWNNAARASRL 
69 cupnh-q0jzs8       9.4%  -VFPDTRVHVVGRSLGTGVAIQLADL--------------------------QDFDSLQLITPYDSLL---ELVRK--------RFPLVP----------LRQL--MRHHFDSISHCKKV 
70 ralme-q1lg65       9.4%  -AFPGVRVHVVGRSLGTGVAIQLADL--------------------------QDFESLQLITPYDSLL---EIVRK--------RFPLVP----------LRQL--MRHHFDSISHCKKV 
71 phopr-Q93CF7      10.5%  -KVNHEQISLMGRSLGSGVATYVAVN--------------------------RQVEKLLLVTPFDSIV---NVAKNI--------YWMFP----------VSLL--LQDKFQSINRAKNI 
72 mimiv-yr595       10.6%  -HYNPNNISLFGESLGCSVAINLAVNISKNFDSKYY------------------PHSLILNSPFYSLS---EMVKSIFHKANLSQFGSVLSN--------------LFREYQSDKLIPFM 
73 enccu-ECU09.0730   7.5%  -SRRSTRKVVVGFSIGAAVGIRLAGM--------------------------CRVDALVLVNPFISLR---EVVSSI-------PLGRV-----------LKHL--VVDEWSNMNGVKDI 
74 dicdi-q54f01      10.2%  -KINSKNIILMGKSIGTISTLKFASELFPKVLKANSSGKSSTASPIESCKQYKSVGGIILLNSFGPGGVSDNIVN--------------------------VLL--SLDAFDHLKRVERI 
75 plafa-MAL7P1.156   9.0%  -NIKNENILLFGRSIGTGVASKLAYNLKLIGVS---------------------VAGIILHSPYISIE---KLVEDYF--------------------TYSSYF--IENIYDNYKNLSFL 
76 thean-q4ue56       7.9%  -GVHPSSIVFFGRSIGTGPAACIAAHFVKKGIK---------------------CGGVILQAPYISIH---KIVQ-----------EYFP---------LGSWL--IDNFWDLEQALKDM 
77 thepa-q4n5d6       6.3%  -GVHPSSIVFFGRSIGTGPAACIAAHFVKKGIK---------------------CGGVILQAPYVSIH---KIVQGNFLIHMKDSVEYFP---------LGSWL--IDNFWDLEQALKDM 
78 butfi-CINII       12.5%  -NIDNNNIFLFGGSQGGLVTTLATEELGDE------------------------VAGMALYFPALCIA---DNWRETFP-----ETDMIPKEEEFWGMTLGKNFFESIHDFDVFSEIGSY 
   consensus/100%           .........h.G.S.Gs.............................................s......................................................... 
   consensus/90%            .....t.hhlhGhS.Gshhsh.hh..............................htsh...ss.......................................................th 
   consensus/80%            ..hs.pphhlhGhShGuhsshthhht.st.........................hsuhh..sshh.................................................tthttl 
   consensus/70%            ..hssp+lhlhGhShGuhsshtlshphsph........................hsuhh.hushh.h..............................................hpphtpl 

 1 9bact-3WYDseq    100.0%  -----AHIPQLVVHGDNDKTVPVERSRVMVEAAK-KHGT--------------------------------------------E-IKYIEIPG-----------GDHVSVA---ART--- 
 2 solue-Q029Y4      56.6%  -----RHIPQYVVHGDDDRTVSVTQSRTMVEAGK-KAGA--------------------------------------------E-IVYVEVPG-----------GSHVGVA---APA--- 
 3 9bact-b8y567      28.8%  -----KHLPMLVLQGDQDRLV--TPTRQWVARMK-ELGM--------------------------------------------E-HIYIEVPG-----------GDHSLFI---SKDR-E 
 4 9bact-b8y568      26.0%  -----QHLSVIVVQGDQDRLVSVEIARRWVAKMK-ELGM--------------------------------------------T-HEYIEIKD-----------GNHVTSI---TQNP-E 
 5 9zzzz-EH82        33.5%  -----RHMPVIIVQGDADTAVPVAVTRRWASKLR-ELQM--------------------------------------------T-FRYIEIPG-----------GDHMGVI---GTG--- 
 6 9bact-estC55.241  27.2%  -----LNLPVHLFQGDADQLVRPEWTREWVRRFR-EAGV--------------------------------------------S-VEYAEYPG-----------VGHDSWV---NAYA-- 
 7 9bact-estC55.165  24.1%  -----KHLPIWVFHGADDPIVSVEASRRMVEALR-ELGA--------------------------------------------D-VQYTEYEG-----------VGHNAWD---PAYA-- 
 8 9bact-estC76.137  25.2%  -----KHLPIWVFHGADDPIVSVEASRRMVEALR-ELGA--------------------------------------------D-VQYTEYEG-----------VGHNAWD---PAYA-- 
 9 9zzzz-t1ci96      20.5%  -----CDVPVWMVHGALDDVIPAEQSRRMAAALR-DAGA--------------------------------------------P-LHYRELPE-----------ANHNAWD---AAYA-- 
10 xanax-XAC2981     20.6%  -----KHVPIWMFHGAKDDSVPPHDDRALYRAAK-GVGA--------------------------------------------N-VRYSEYPQ-----------GNHNAWD---ATYA-- 
11 xanor-q5h3e2      20.6%  -----KHVPIWMFHGAKDDSVPPHDDRALYRAAK-GVGA--------------------------------------------N-VRYSEYPE-----------GNHNAWD---ATYA-- 
12 xanca-XCC2811     20.3%  -----KHVPIWMFHGAKDEAVPPHDDRALYRAAK-GVGA--------------------------------------------N-VRYSEYPN-----------GNHNAWD---ATYA-- 
13 rhoba-q7ule9      21.1%  -----ATLPIWAFHGGKDFVVELKESEEMVAAIQ-RAGG--------------------------------------------D-VKLTIYPE-----------AGHDSWT---ETYA-- 
14 rhofd-q21zf7      24.9%  -----KNIPIWAFHGEKDTVVSLQDDAAMVAAVK-ACGG--------------------------------------------D-VKFTVYPG-----------VGHDSWT---QTYA-- 
15 symth-q67nt3      26.0%  -----ARVPFWVFHGELDDKVPAALSAQMVAALQ-AVGA--------------------------------------------P-VRYTVYPG-----------VGHDAWT---PTYA-- 
16 rhime-RB0531      24.8%  ----NEKAAFWVFHGSNDGVIPLSDSVVLYERLK-ALDR--------------------------------------------N-ARLTVLEG-----------VDHSGVE--WATLN-- 
17 flaj1-a5fe33      21.2%  -----ANIPTRIFHGLLDDVVNVNYAITIYKELK-KCNAK-------------------------------------------D-VKLTIFDD-----------ANHDSWT---KVYD-- 
18 bacfr-q64n33      25.1%  -----ANVRFRIFHGDADNVVPVEGSREAYRALK-NLGA--------------------------------------------E-VEYIEFPG-----------CNHGSWN---PAFN-- 
19 bactn-BT3286      23.0%  -----KEVKFRIFHGDADDVVTVEGSREAYKALK-AAGA--------------------------------------------K-VEYIEFPG-----------CNHGSWN---PAFN-- 
20 bacsk-q5wbk1      25.9%  -----KDVPIWAFHGEDDKIIDVSGSRLMVEALE-KVGG--------------------------------------------H-IRYTEFKTGELR-------SPHSAWG---PVYE-- 
21 thema-TM0033      17.2%  -----KDIPIWVFHAEDDPVVPVENSRVLVKKLA-EIGG--------------------------------------------K-VRYTEYEKGFMEKHG---WDPHGSWI---PTYE-- 
22 anavt-q3m5j3      23.3%  -----KEIPIQIFQGAKDEKLSVEDTQQIVDTLH-GLGG--------------------------------------------T-VDFTVIPE-----------GDHFIAD---EVYT-- 
23 nosco-q3i1p4      24.2%  -----KNIPVQIFQGGQDKNLPIEDTEIFVERLR-NVGG--------------------------------------------K-VDLTVLPE-----------GDHFIAD---EVYG-- 
24 actsz-a6vkk1      19.6%  -----KDIPMWFFHSKEDKISPVTGSRINVDLLK-TLNAP-------------------------------------------H-VKYTEFTTEQAGDNGITNSNAHNTWD---AVFN-- 
25 pasmu-PM1358      17.5%  -----KNTPIWFFHSIEDKVSPVAGSRINYAILKDEVKSD-------------------------------------------K-VKYTEFTMQQAGDNGIVNNNPHNTWD---AVFN-- 
26 myxxd-q1cxe9      16.4%  ---VQANLPIWGSHGLLDNDIFYTATAGWFTHLGHAMGGTGGVMDTYPSPARTATAFFRPGSGQWEWIDGQTNTDTTGAGPVKP-VLFTLFHD-----------GNHYIWD---RVYK-- 
27 stiad-q09av6      15.4%  ---ISAGLPIWAAQAVNDEQYSYMATVAWFDQFGQAMGATGGILSTYTSPREKQTAFFRPATGRWEWISGQTATDPTGAGPERP-VLFTLYDT-----------GGHGIWD---KVYQ-- 
28 halo1-d0lmj0      15.9%  -----AQVPIWGFHGDADPTVAPAGTIEPMNGLI-ACAQ-----------------------------------------PRAD-QQLTVYEG-----------VGHDSWS---RTYSLS 
29 stiad-q09db1      16.5%  -----LNVPVWGVHSFADGSSLSAERSWLTGVTK-NYGQNQSV--SVPSAPSTQTYLFSAATHAW---TPQPGVDATG---NFI-ARLTVYPG-----------SAHDCWT---QTYD-- 
30 mycua-a0pqs2      25.4%  -----RWLPLVIAHGLLDELVPFPSVAEQVLELD-RLGY--------------------------------------------R-HRFTVYPF-----------EDHIAW---------- 
31 braja-BLL1350     14.0%  -----QRLPIFITHGKLDWMFPVQTARQTQAALS-AAGA--------------------------------------------D-VVYREIDD-----------LSHTYPR--------E 
32 rhopa-q6ncc5      16.3%  -----RGLPIQIVHGRHDWMFPVEVARQAHEALV-SAGA--------------------------------------------D-VSYREIAD-----------LSHSYPR--------E 
33 rhopa-q37hi0      14.7%  -----RGLPIQIVHGRHDWMFPVELARQAQQALF-KAGA--------------------------------------------D-VSYREIAD-----------LSHTYPR--------E 
34 pseal-PHAZ        16.1%  --LPADHPPTLFLHGFVDAVVPWWSMDLYYDRLL-HQGI--------------------------------------------ETARYTE---P---------LGGHEWFA--------A 
35 psefl-phaz        16.1%  --LPADHPPTLFLHGFVDAVVPWWSMDLYYDRLL-HQGI--------------------------------------------ETARYTE---P---------LGGHEWFA--------A 
36 psepa-q6vqy9      12.8%  -----LDKPVLFCRGQFDDVIPRHKFEQAEAYLSGPSGA--------------------------------------------R-ATFIPYEG------------GHELPL--------P 
37 bacha-BH2917      11.5%  -----NNRPLYLWHGERDNVVPFAYSQQLNEQLQ-QRNYEQ--------------------------------------------VVFTSDPR-----------GDHKVSR--------A 
38 bacsu-YITV        13.8%  -----QQRPLLFWHGAKDKVVPYAPTRKFYDTIK-SHYSEQP---------------------------------------E-R-LQFIGDEN-----------ADHKVPR--------A 
39 lisin-LIN2363     12.6%  -----NNRPLLLWHGKKDDVVPFAYSEKLYQTLV-EESLAD------------------------------------------N-VEFIIDDN-----------AKHKVSV--------E 
40 lismo-LMO2262     12.6%  -----NNRPLLLWHGKKDDVVPFAYSEKLYQTLV-EESLAD------------------------------------------N-VQFIIDDN-----------AKHKVSV--------E 
41 oceih-OB1195      13.9%  -----DQRPVMFWHGDKDPVVPFEHSFLFYQEVK-DTYLDQ----------------------------------------Q-N-IKFIKEPG-----------VGHKVSL--------N 
42 ecoli-yjfp        13.8%  -----SDRPLLLWHGLDDDVVPADESLRLQQALS-ETGRDK------------------------------------------L-LTCSWQPG-----------VRHRITP--------E 
43 shifl-YJFP        13.8%  -----GDRPLLLWHGLDDDVVPADESLRLQQALS-ETGRDK------------------------------------------L-LTCSWQPG-----------VRHRITP--------E 
44 salty-YJFP        12.3%  -----ADRPLLLWHGQEDDVVPAIETFRLQQALA-GAKLDK------------------------------------------H-VTCLWAAG-----------VRHRITP--------E 
45 entcc-a0a0h3cfu5  13.8%  -----ADRPLLLWHGDADDVVPPGETFRLQQALQ-REGLDG------------------------------------------N-LTCLWEAG-----------VRHRITP--------A 
46 entcl-a0a157v5g4  13.2%  -----ADKPLLLWHGDADDVVPPGDTFRLQQALT-QSGLAT------------------------------------------N-LTCHWQKG-----------VRHRITP--------E 
47 erwct-q6d134      14.9%  -----SNRPLLVWHGEADDVVPAAESARLHQALQ-ARGTLA------------------------------------------N-LTYLTEPG-----------VAHRITP--------T 
48 yerpe-Y0644       14.6%  -----TERPLLVWHGEADDVVPAAESARLVQALR-TRGGDN------------------------------------------N-LTYLTEAG-----------IGHKITP--------T 
49 entfa-EF2792      13.4%  -----QERPMLFWHGTEDEKIPYEDMADFEQLVS-GKTYAR------------------------------------------N-TQFITEIG-----------ERHLVKG--------E 
50 lacss-q38vr0      13.1%  -----ANRPVLFWHGTEDERIPYNQMADFERQIK-GQSYAQ------------------------------------------N-VTFMTGQG-----------ERHLVQP--------A 
51 lacpl-LP.1760     15.2%  -----NHRPLLFWHGTEDERIPYSQSRNFFDRVH-TAPYAE------------------------------------------Q-VAFITGYQ-----------AKHLVKV--------P 
52 entfc-q3xxj0      12.4%  -----AGRPLFFWHGQADEKIPYIQTERFVEKNR-HKSYGK------------------------------------------E-IVFRSSKT-----------QRHMVQI--------P 
53 lacpl-LP.2631     12.5%  -----AGRPMFFFNGTADQMVPYQYIRDFKHRFK-DEPALK------------------------------------------A-TVFKRAEG-----------GVHHVPH--------K 
54 aciac-a1tlq0      11.9%  ------GSPLLVVHGSDDSLIPPTLGKRLYEAAQ-G-----------------------------------------------P-KRFVLVEG-----------GTHHSTN---SVGEAQ 
55 polna-a1vle4      11.5%  ------GSPLLVVHGTKDTMILPSLGRKLYEAAQ-Q-----------------------------------------------P-KAFVLVEG-----------GSHFNTN---TLGQAQ 
56 polsj-q128b8      11.6%  ------GSPLLVVHGGEDRLILPDLGRKLFDAAT-Q-----------------------------------------------P-KLFMLVEG-----------GSHHNTN---LVGQPQ 
57 comte-a0hgv8      12.0%  ------GSPLLVVHGTADPLIPARLGRQLFDAAR-E-----------------------------------------------P-KRLILVEG-----------ASHHNTQ---SKALVQ 
58 pse14-q48gq9      13.4%  ------HMPVLIVHGTEDRYVPARFSEQLFEAAQ-E-----------------------------------------------P-KKLILVPG-----------GTHNNSM---QIGQPA 
59 pseu2-q4zr46      13.6%  ------HMPVLIVHGTEDRYVPARFSEQLFEAAQ-E-----------------------------------------------P-KKLLLVPG-----------GTHNNSM---QLGQPA 
60 psesy-PSPTO3572   12.9%  ------HMPVLIVHGTEDRYVPARFSEQLFAAAK-E-----------------------------------------------P-KKLILVPG-----------GTHNNSM---QIGQPT 
61 psef5-q4kaz4      10.7%  ------GMPLLVVHGLKDDYVPPRLSKELFQAAL-E-----------------------------------------------P-KKLLLVPG-----------GTHNNSM---RLAGKD 
62 psepf-q3kew2      12.3%  ------HMPLLVVHGLADAFVPSRFSEQLFAAAR-Q-----------------------------------------------P-KRLLLVPG-----------ATHNNSM---ALGGQN 
63 psepu-a1fc94      10.6%  ------GLPLLLVHGLDDRFVPPRFSQQLFEAAQ-E-----------------------------------------------P-KTLLLVPG-----------ASHNNSM---SRAGQR 
64 borpe-q7vsl4      13.6%  ------TTPMLLLHGTADRVVPHTMSDELYRAAQ-QVPA--------------------------------------------DLKRLVKIEG-----------ASHSGAI---RSGR-I 
65 chrvo-q7nww4      10.4%  ------AIPKLFIHCRSDEIVPFFLGEKLYQAAG------------------------------------------------LP-KTRLILEK-----------GGHQTCS---HADAAL 
66 synp6-q5n0k4      13.0%  ------SVPVLILHGEADTEVPALMSEALFLAAA------------------------------------------------GP-KQLCRIPD-----------GGHNDLP---KLAGDR 
67 lepin-LA3770      10.1%  ------ILPVLIIHGKKDVAVPYYMGETLNKSFS-------------------------------------------------N-AKLITLFN-----------ANHSLFG---SITE-T 
68 cupnh-q0k226       7.5%  ------ERPLLVVHSRDDAVIVPPHAERVARAAR-------------------------------------------------HLHALVMLDA-----------MPHDAAILP-EHIE-A 
69 cupnh-q0jzs8       9.4%  ------VQSTKVLLAETDEVVPHECSERLMAAWP------------------------------------------------GP-VALQTVPA-----------TNHFTIIERE-----E 
70 ralme-q1lg65       9.4%  ------VQSTKVLLAESDDVVPHECSERLMAAWP------------------------------------------------GP-VALQMISG-----------VDHYTIIERW-----E 
71 phopr-Q93CF7      10.5%  ------TAQTYIFIAENDRVIPRARSERLKAQFT-E-----------------------------------------------QLIDSVLVSG-----------ADHNDISLYP-----E 
72 mimiv-yr595       10.6%  ----NQHTKIIIAHSHNDEIIPFEQGFKLYQLIA-NTHT--------------------------------------------N-SKFIIING------------SHNNPGLPD-----E 
73 enccu-ECU09.0730   7.5%  ------DVPVYFVVSSDDEIVPESHADALIKRTR-------------------------------------------------H-PRKIVIRN-----------ADHNEPMR-------N 
74 dicdi-q54f01      10.2%  ------TCPVLLIHSEDDQIVNVKCSKKLAKLFN-------------------------------------------------NLHKFTMVKE-----------AGHWNLE---THYLDD 
75 plafa-MAL7P1.156   9.0%  SNNTDSDIPILLIHGKEDEIIHVSHSEYLMKNLN-N-----------------------------------------------K-FKHASYPT----------DSYHNYYYVID-----D 
76 thean-q4ue56       7.9%  ----SPSVPLLIIHGLLDEIVPVSHGQRLYDSYE-S-----------------------------------------------E-NKMADFQP----------NSKHNYYSINE-----D 
77 thepa-q4n5d6       6.3%  ----SPSVPLLIIHGLLDEIVPVSHGQRLYDSYE-S-----------------------------------------------E-NKMADFQP----------NSKHNYYSINE-----D 
78 butfi-CINII       12.5%  ------PNNVLILHGDKDEIVPLSYSEKAASIYE-------------------------------------------------H-AKLIVMEG-----------EGHGFAP---EAAK-T 
   consensus/100%           ...........h..s..D........................................................................................H............. 
   consensus/90%            ......t.shhhhpu..D.hl....s..h.t.h....................................................h.hh...t............tH............. 
   consensus/80%            ......thPhhhhHGttDthls.t.stthhttht.t.................................................hphh.h.s...........ssH............. 
   consensus/70%            ......phPlhhhHGttDphlPht.spphhpthp.t...............................................p.hphh.h.s...........ssHp.h.......... 

 1 9bact-3WYDseq    100.0%  -FKDVFDWFDSHKRKRPAAKAATNK----------------------------------------------------------------------------------------------- 
 2 solue-Q029Y4      56.6%  -FPGMLDFFAKQKKDAAQ------------------------------------------------------------------------------------------------------ 
 3 9bact-b8y567      28.8%  MMAKVFDFFKIIGNRGRGG----------------------------------------------------------------------------------------------------- 
 4 9bact-b8y568      26.0%  MIGKIFAFFNAHTRRDALEPAGAVAGE---------------------------------------------------------------------------------------GF---- 
 5 9zzzz-EH82        33.5%  -MPDIFAFFEAHPKNHH------------------------------------------------------------------------------------------------------- 
 6 9bact-estC55.241  27.2%  -DGQIFEWFGQFRRNR-------------------------------------------------------------------------------------------------------- 
 7 9bact-estC55.165  24.1%  -EFALMPWLLSHRRPKE------------------------------------------------------------------------------------------------------- 
 8 9bact-estC76.137  25.2%  -EQALMPWLLSHRRPKK------------------------------------------------------------------------------------------------------- 
 9 9zzzz-t1ci96      20.5%  -DARLWQWLQRMLN---------------------------------------------------------------------------------------------------------- 
10 xanax-XAC2981     20.6%  -DPAMWEWMFKQRLR--------------------------------------------------------------------------------------------------------- 
11 xanor-q5h3e2      20.6%  -DPAMWKWMFKQRLR--------------------------------------------------------------------------------------------------------- 
12 xanca-XCC2811     20.3%  -DPAMWEWMFKQRLR--------------------------------------------------------------------------------------------------------- 
13 rhoba-q7ule9      21.1%  -NPEVYAWLLRHQNEK-------------------------------------------------------------------------------------------------------- 
14 rhofd-q21zf7      24.9%  -NPALYEWFLQHKRKPVEP----------------------------------------------------------------------------------------------------- 
15 symth-q67nt3      26.0%  -NAELYQWFLAHRRSGEPAAGPV------------------------------------------------------------------------------------------------- 
16 rhime-RB0531      24.8%  -DAELWDWLLKQRLEGAPQ----------------------------------------------------------------------------------------------------- 
17 flaj1-a5fe33      21.2%  -NQEIYDWMFQQKKTNTNK----------------------------------------------------------------------------------------------------- 
18 bacfr-q64n33      25.1%  -YPGFMEWVFAQRKR--------------------------------------------------------------------------------------------------------- 
19 bactn-BT3286      23.0%  -YPGFMEWLFKQKK---------------------------------------------------------------------------------------------------------- 
20 bacsk-q5wbk1      25.9%  -DKRVIEWLYAQSRAN-------------------------------------------------------------------------------------------------------- 
21 thema-TM0033      17.2%  -NQEAIEWLFEQSR---------------------------------------------------------------------------------------------------------- 
22 anavt-q3m5j3      23.3%  -DSKLQQWLISQSRRPASVVA--------------------------------------------------------------------------------------------------- 
23 nosco-q3i1p4      24.2%  -NPKLQQWLISQNRREISVVA--------------------------------------------------------------------------------------------------- 
24 actsz-a6vkk1      19.6%  -SPEVMQWLLQQKRQ--------------------------------------------------------------------------------------------------------- 
25 pasmu-PM1358      17.5%  -SPEAIMWLLNQRLTK-------------------------------------------------------------------------------------------------------- 
26 myxxd-q1cxe9      16.4%  -EPKVFAWMLAQQRP--------------------------------------------------------------------------------------------------------- 
27 stiad-q09av6      15.4%  -DPKVWDWLLSQQRP--------------------------------------------------------------------------------------------------------- 
28 halo1-d0lmj0      15.9%  AGHDIYAWLLSQSR---------------------------------------------------------------------------------------------------------- 
29 stiad-q09db1      16.5%  -NEAFWDWMLAQQRVP-------------------------------------------------------------------------------------------------------- 
30 mycua-a0pqs2      25.4%  ------------------------------------------------------------------------------------------------------------------------ 
31 braja-BLL1350     14.0%  INAELLAWLNG------------------------------------------------------------------------------------------------------------- 
32 rhopa-q6ncc5      16.3%  ANVALLDWLKVPAA---------------------------------------------------------------------------------------------------------- 
33 rhopa-q37hi0      14.7%  LNAALLDWLNGAG----------------------------------------------------------------------------------------------------------- 
34 pseal-PHAZ        16.1%  SPSKVLAWFNAHP----------------------------------------------------------------------------------------------------------- 
35 psefl-phaz        16.1%  SPGKVLAWFNAHP----------------------------------------------------------------------------------------------------------- 
36 psepa-q6vqy9      12.8%  IKAAVQGWLGAESR---------------------------------------------------------------------------------------------------------- 
37 bacha-BH2917      11.5%  ALLESVDWMARQLMPTTTS----------------------------------------------------------VRT---------------------------------------- 
38 bacsu-YITV        13.8%  AVLKTIEWFETYL----------------------------------------------------------------------------------------------------------- 
39 lisin-LIN2363     12.6%  GMLQGVSFFEKFL----------------------------------------------------------------------------------------------------------- 
40 lismo-LMO2262     12.6%  GMLQGVSFFEKFL----------------------------------------------------------------------------------------------------------- 
41 oceih-OB1195      13.9%  GYQEATKWFEKHLL---------------------------------------------------------------------------------------------------------- 
42 ecoli-yjfp        13.8%  ALDAAVTFFRQHL----------------------------------------------------------------------------------------------------------- 
43 shifl-YJFP        13.8%  ALDAAVTFFRQHL----------------------------------------------------------------------------------------------------------- 
44 salty-YJFP        12.3%  ALSATVAFFRQHL----------------------------------------------------------------------------------------------------------- 
45 entcc-a0a0h3cfu5  13.8%  ALDATVDFFRQHL----------------------------------------------------------------------------------------------------------- 
46 entcl-a0a157v5g4  13.2%  ALDATTAFFLRHL----------------------------------------------------------------------------------------------------------- 
47 erwct-q6d134      14.9%  ALQAGADFFQRTL----------------------------------------------------------------------------------------------------------- 
48 yerpe-Y0644       14.6%  ALRAGSDFFTQYL----------------------------------------------------------------------------------------------------------- 
49 entfa-EF2792      13.4%  TMDLVVDFFKEASKTLEK------------------------------------------------------------------------------------------------------ 
50 lacss-q38vr0      13.1%  LMTTITDFFATHLKIKSE------------------------------------------------------------------------------------------------------ 
51 lacpl-LP.1760     15.2%  LMNKVANFFDYYLN---------------------------------------------------------------------------------------------------------- 
52 entfc-q3xxj0      12.4%  LMEEASTFLAKNLIKKYK------------------------------------------------------------------------------------------------------ 
53 lacpl-LP.2631     12.5%  IQEAAVAFLETNILK--------------------------------------------------------------------------------------------------------- 
54 aciac-a1tlq0      11.9%  YREALADLFRIPAGPMPARAPAQRATAPGSAA---------------------------------------------------------------------------------------- 
55 polna-a1vle4      11.5%  YRVALADLFGARAAGTLV---TQR------------------------------------------------------------------------------------------------ 
56 polsj-q128b8      11.6%  YRQALAQLFQLK------------------------------------------------------------------------------------------------------------ 
57 comte-a0hgv8      12.0%  YRQALHELFGLNPR---------------------------------------------------------------------------------------------------------- 
58 pse14-q48gq9      13.4%  YSRAIRTLLDTPASLPRVTTQDQPSKNAG------------------------------------------------------------------------------------------- 
59 pseu2-q4zr46      13.6%  YSQAIRALLDTPASLPQVTQQGKDSKNAG------------------------------------------------------------------------------------------- 
60 psesy-PSPTO3572   12.9%  YSRAIRSLLDTPATPSQANRQNKGQKDAG------------------------------------------------------------------------------------------- 
61 psef5-q4kaz4      10.7%  YGQAINALLRAKPSQKFAGPPPAAAPTS-------------------------------------------------------------------------------------------- 
62 psepf-q3kew2      12.3%  YRKAIDALMQTRPAARVAGAAVQKNPRDS------------------------------------------------------------------------------------------- 
63 psepu-a1fc94      10.6%  YQRAIQALL--------------------------------------------------------------------------------------------------------------- 
64 borpe-q7vsl4      13.6%  YEDAVADFVRDAGRGYAGRQGAPTPLTASRPGT--------------------------------------------------------------------------------------- 
65 chrvo-q7nww4      10.4%  WKNAMRMIMSKNSST--------------------------------------------------------------------------------------------------------- 
66 synp6-q5n0k4      13.0%  YRQAFQRFLDLVAARSRA------------------------------------------------------------------------------------------------------ 
67 lepin-LA3770      10.1%  HWKLIRDFIQ-------------------------------------------------------------------------------------------------------------- 
68 cupnh-q0k226       7.5%  FWPPILRFVRAQDGDAMQALLAGNDAKYEGDPP---------GNADQAGTSTS---RTGTLATAS------------------------------------------------------- 
69 cupnh-q0jzs8       9.4%  TWLALCEFARHHGQARLRVATAQPAPPAATGTP--------PIDHDELG-------NPLPLAAGR------------------------------------------------------- 
70 ralme-q1lg65       9.4%  TWHALCEFARE---------VPHQPPDRTQQHP--------PSDHTESG-------VPLPLPAAR------------------------------------------------------- 
71 phopr-Q93CF7      10.5%  YIAGVKRALQSY------------------------------------------------------------------------------------------------------------ 
72 mimiv-yr595       10.6%  YIYTLADLFND------------------------------------------------------------------------------------------------------------- 
73 enccu-ECU09.0730   7.5%  FMVHVLPVVSEALVDGRQ------------------------------------------------------------------------------------------------------ 
74 dicdi-q54f01      10.2%  YEDDLIEFVKLVSPEQ-------------------------------------------------------------------------------------------------------- 
75 plafa-MAL7P1.156   9.0%  LGIPIKIFLETLSKSKNAKSVDINIP---------------------------------------------------------------------------------------------- 
76 thean-q4ue56       7.9%  LIVPIRKFLNKFNISTYNPPVEINLPSWCLTKSKNVLRRRKSNNTDKSYKSAIDSMRSLSI-------FH---------------------------------FCSFSFSSQL------- 
77 thepa-q4n5d6       6.3%  LIVPIRKFLNKFNISAYNPPMEITLPRWCLSKSKNVLRRRRSNNSDKSFKTTTESMRSLTLSSSRTSSIHTRTQVSTARTSVSASSLLQESIPPELDSDVNRSICHSNFSSSLEGLCQRN 
78 butfi-CINII       12.5%  AREDVLSFMKENIR---------------------------------------------------------------------------------------------------------- 
   consensus/100%           ........................................................................................................................ 
   consensus/90%            ...th.thh............................................................................................................... 
   consensus/80%            ...thhtah.t............................................................................................................. 
   consensus/70%            ...thhpah.t............................................................................................................. 

 1 9bact-3WYDseq    100.0%  --------------------- 
 2 solue-Q029Y4      56.6%  --------------------- 
 3 9bact-b8y567      28.8%  --------------------- 
 4 9bact-b8y568      26.0%  --------------------- 
 5 9zzzz-EH82        33.5%  --------------------- 
 6 9bact-estC55.241  27.2%  --------------------- 
 7 9bact-estC55.165  24.1%  --------------------- 
 8 9bact-estC76.137  25.2%  --------------------- 
 9 9zzzz-t1ci96      20.5%  --------------------- 
10 xanax-XAC2981     20.6%  --------------------- 
11 xanor-q5h3e2      20.6%  --------------------- 
12 xanca-XCC2811     20.3%  --------------------- 
13 rhoba-q7ule9      21.1%  --------------------- 
14 rhofd-q21zf7      24.9%  --------------------- 
15 symth-q67nt3      26.0%  --------------------- 
16 rhime-RB0531      24.8%  --------------------- 
17 flaj1-a5fe33      21.2%  --------------------- 
18 bacfr-q64n33      25.1%  --------------------- 
19 bactn-BT3286      23.0%  --------------------- 
20 bacsk-q5wbk1      25.9%  --------------------- 
21 thema-TM0033      17.2%  --------------------- 
22 anavt-q3m5j3      23.3%  --------------------- 
23 nosco-q3i1p4      24.2%  --------------------- 
24 actsz-a6vkk1      19.6%  --------------------- 
25 pasmu-PM1358      17.5%  --------------------- 
26 myxxd-q1cxe9      16.4%  --------------------- 
27 stiad-q09av6      15.4%  --------------------- 
28 halo1-d0lmj0      15.9%  --------------------- 
29 stiad-q09db1      16.5%  --------------------- 
30 mycua-a0pqs2      25.4%  --------------------- 
31 braja-BLL1350     14.0%  --------------------- 
32 rhopa-q6ncc5      16.3%  --------------------- 
33 rhopa-q37hi0      14.7%  --------------------- 
34 pseal-PHAZ        16.1%  --------------------- 
35 psefl-phaz        16.1%  --------------------- 
36 psepa-q6vqy9      12.8%  --------------------- 
37 bacha-BH2917      11.5%  --------------------- 
38 bacsu-YITV        13.8%  --------------------- 
39 lisin-LIN2363     12.6%  --------------------- 
40 lismo-LMO2262     12.6%  --------------------- 
41 oceih-OB1195      13.9%  --------------------- 
42 ecoli-yjfp        13.8%  --------------------- 
43 shifl-YJFP        13.8%  --------------------- 
44 salty-YJFP        12.3%  --------------------- 
45 entcc-a0a0h3cfu5  13.8%  --------------------- 
46 entcl-a0a157v5g4  13.2%  --------------------- 
47 erwct-q6d134      14.9%  --------------------- 
48 yerpe-Y0644       14.6%  --------------------- 
49 entfa-EF2792      13.4%  --------------------- 
50 lacss-q38vr0      13.1%  --------------------- 
51 lacpl-LP.1760     15.2%  --------------------- 
52 entfc-q3xxj0      12.4%  --------------------- 
53 lacpl-LP.2631     12.5%  --------------------- 
54 aciac-a1tlq0      11.9%  --------------------- 
55 polna-a1vle4      11.5%  --------------------- 
56 polsj-q128b8      11.6%  --------------------- 
57 comte-a0hgv8      12.0%  --------------------- 
58 pse14-q48gq9      13.4%  --------------------- 
59 pseu2-q4zr46      13.6%  --------------------- 
60 psesy-PSPTO3572   12.9%  --------------------- 
61 psef5-q4kaz4      10.7%  --------------------- 
62 psepf-q3kew2      12.3%  --------------------- 
63 psepu-a1fc94      10.6%  --------------------- 
64 borpe-q7vsl4      13.6%  --------------------- 
65 chrvo-q7nww4      10.4%  --------------------- 
66 synp6-q5n0k4      13.0%  --------------------- 
67 lepin-LA3770      10.1%  --------------------- 
68 cupnh-q0k226       7.5%  ---GERRQ------------- 
69 cupnh-q0jzs8       9.4%  --------------------- 
70 ralme-q1lg65       9.4%  --------------------- 
71 phopr-Q93CF7      10.5%  --------------------- 
72 mimiv-yr595       10.6%  --------------------W 
73 enccu-ECU09.0730   7.5%  ---LDDKE------------- 
74 dicdi-q54f01      10.2%  --------------------- 
75 plafa-MAL7P1.156   9.0%  --------------------- 
76 thean-q4ue56       7.9%  ---LED--------------- 
77 thepa-q4n5d6       6.3%  SINNEDISDMVNDAITRNNNP 
78 butfi-CINII       12.5%  --------------------- 
   consensus/100%           ..................... 
   consensus/90%            ..................... 
   consensus/80%            ..................... 
   consensus/70%            ..................... 

MView 1.56, Copyright © 1997-2013 Nigel P. Brown

#protein: highlight amino acid physicochemical properties
hydrophobic          =>  bright-green      { A, G, I, L, M, P, V }
large hydrophobic    =>  dark-green        { F, H, W, Y }
cystein              =>  yellow            { C }
negative charge      =>  bright-blue       { D, E }
positive charge      =>  bright-red        { K, R }
polar                =>  purple            { N, Q }
small alcohol        =>  dull-blue         { S , T }
any       => dark-gray                     { X }
#protein consensus: report conserved physicochemical classes, derived from the Venn diagrams of Taylor W. R. (1986).
# The classification of amino acid conservation.
#J. Theor. Biol. 119:205-218.
alcohol          =>  o       { S, T }
aliphatic        =>  l       { I, L, V }
aromatic         =>  a       { F, H, W, Y }
charged          =>  c       { D, E, H, K, R }
hydrophobic      =>  h       { A, C, F, G, H, I, K, L, M, R, T, V, W, Y }
negative         =>  -       { D, E }
polar            =>  p       { C, D, E, H, K, N, Q, R, S, T }
positive         =>  +       { H, K, R }
small            =>  s       { A, C, D, G, N, P, S, T, V }
tiny             =>  u       { A, G, S }
turnlike         =>  t       { A, C, D, E, G, H, K, N, Q, R, S, T }