Reference sequence (1): 9burk-b1g6q9
Identities normalised by aligned length.
Colored by: consensus/70% and property
 1 9burk-b1g6q9   100.0%  ----------------------M-DGAKQFSRSRD--------------------------------------------------------------INAKVARILTKRSAVAHEHLTER 
 2 9burk-b5wax2    67.4%  ----------------------M-DAETLLSHSQD--------------------------------------------------------------ITAKITRVLQKRTQNAQRHLNDR 
 3 9burk-b5wqb7    65.1%  ----------------------M-DQVTQPPRNQE--------------------------------------------------------------IALKILRLLHNRLEEARQRFGQR 
 4 burs3-q391x0    67.5%  ----------------------M-DAATQLARSHE--------------------------------------------------------------IAAEIVHVLQKRTQHALEQYGKR 
 5 cupnh-q0k0q7    64.5%  ----------------------M-DAAKQLVHARE--------------------------------------------------------------VGLKTGMVLQKRLKNAQEAFSGR 
 6 cuptr-b3r4w6    64.6%  ----------------------M-DAAKQLVRARE--------------------------------------------------------------VGLKTGMVLQKRLRHAQEVYSGR 
 7 cuppj-q472w1    63.6%  ----------------------M-DAGKQLAHARE--------------------------------------------------------------VGIKTSVVLQKRLKNAQEAFSHR 
 8 azovd-c1dgm6    61.2%  ----------------------M------------------------------------------------------------------------------------------------- 
 9 metno-b8ihj3    46.9%  ----------------------MADSQT----SQP----------------------ATSDGPPTLMS-----------------------------LQARIAEVYQRRCAAALQGYLDA 
10 mets4-b0umc8    45.9%  ----------------------MADPGTRVYPRQA----------------------PTTGSLQPLLP-----------------------------LQLRIAEVYRERCATALDAYLDA 
11 xanp2-a7ikd9    37.9%  ----------------------M--------------------------------------NPFDMMK-----------------------------VYGRVAEIYRLRLGEAVSAYGVA 
12 aroae-q5p962    32.4%  ----------------------M------------------------------------------------------------------------------------------------- 
13 chrsd-q1qx98    37.1%  ----------------------M----------------FP------------------------------------------------------------------------------- 
14 borpd-a9hzm8    35.2%  ----------------------M----------------------------------RGGHPPES------------------------------------------------------- 
15 borpe-q7vzb4    34.5%  ----------------------M----------------------------------AASAADRT------------------------------------------------------- 
16 burp8-b2jmm5    35.0%  ----------------------M-----------------------------------NQSQPISA------------------------------------------------------ 
17 ralso-b5s536    35.4%  ----------------------M------------------------------------------------------------------------------------------------- 
18 burvg-a4js32    35.6%  ----------------------M------------------------------------------------------------------------------------------------- 
19 comte-b7wqc8    31.9%  MCLR-PLAIQFFSFITEGVPIAM------------------------------------------------------------------------------------------------- 
20 parl1-a7hyr7    36.3%  ----------------------M------------------------------------------------------------------------------------------------- 
21 delas-a9brz2    33.6%  ----------------------M------------------------------------------------------------------------------------------------- 
22 nitec-q0ajy0    34.3%  ----------------------M--------------------------ITKKSYRSHETVRPEAAEE---------------------------------------------------- 
23 comt2-d0j233    35.2%  ------------------------------------------------------------------------------------------------------------------------ 
24 comte-b7x1q8    33.0%  ----------------------M------------------------------------------------------------------------------------------------- 
25 beii9-b2iia7    35.6%  ----------------------M------------------------------------------------------------------------------------------------- 
26 braja-BLR3456   35.2%  ----------------------M------------------------------------------------------------------------------------------------- 
27 nithx-q1qpw8    35.6%  ----------------------M------------------------------------------------------------------------------------------------- 
28 rhime-yack      35.5%  ----------------------M------------------------------------------------------------------------------------------------- 
29 rhisn-c3krv5    36.8%  ----------------------M------------------------------------------------------------------------------------------------- 
30 brasb-a5eg29    36.4%  ----------------------M------------------------------------------------------------------------------------------------- 
31 azos1-d3p281    36.0%  ----------------------M-------------------------------------MWP--------------------------------------------------------- 
32 beii9-b2icg9    36.5%  ----------------------M-TNERQGETPDF------------------FTNPFTAFWPTGAKNG----------------------------------FSIPAFPSELFPSFLSP 
33 metsb-b8ert2    37.3%  ----------------------M----------------------------------DNTTKPAE------------------------------------IFSAFSQFWSSALPSAVSP 
34 azosb-a1k5s0    35.9%  ----------------------M-----------------------------------------------------------------------------------QLFPSPLAPSGHAL 
35 chrvo-q7nwh6    35.3%  ----------------------M------------------------------------------------------------------------------------------------- 
36 chrvo-q7p1c7    36.6%  ----------------------M------------------------------------------------------------------------------------------------- 
37 cupnh-q0kdv2    38.9%  ----------------------M-----------------------------------------------------------------------------------TARERADLPRDSSA 
38 cuppj-q475c4    38.4%  ----------------------M-----------------------------------------------------------------------------------SASESTGTPGTQSG 
39 ralme-q1lqx6    41.4%  ----------------------M-----------------------------------------------------------------------------------TARQPTAVTSTAEA 
40 acicj-a5ft95    35.2%  ----------------------M------------------------------TIDFAARHKPAPGRA---------------------------------------------------- 
41 azoc5-a8ih86    33.7%  ----------------------M---------------------------------AGESATPAPLQPGTWG-----------------------------------------QPGHQAA 
42 azosb-a1k696    41.1%  ----------------------M--------------------------------PLSAGSGPAFLSVVP---------------------------ARRPATRAGRRRLATSVLARHDH 
43 9rhob-a0p290    35.6%  ----------------------MRDIFDALEKGQNEF--------------LESLHDATAWGPSERFT------------------ALQAQATELSNLGELMGRGLSKHLTRISDDHKSR 
44 9rhob-b9r693    36.5%  ----------------------MKDIFDAFEKGQNEF--------------LNSLNDATAWGPSERFT------------------ALQAQGTELSNLAELMGRGLSKHFEKITADHKGR 
45 meted-c7cnd9    37.5%  ----------------------M------------------------------------------------------------------------------------------------- 
46 brasb-a5ef53    38.5%  ----------------------M----------------------------------SSPYSPATALA------------------RSFGAAGITTTQTQRVSQSLSRHLDKFAREHGKR 
47 braso-a4z1h1    38.2%  ----------------------M----------------------------------SSPYSPATAGA------------------RAFGAANITTTQTQRVSQSLSRHLDKFAREHGKR 
48 rhop5-q07lt7    39.2%  ----------------------M----------------------------------EPHFSPDQMPE------------------RVAATIDGTIRQGELMSKAFQRHAERISRTHSKR 
49 metsb-b8eqs6    37.0%  ----------------------M----------------------------------EPSFSPVDRAR------------------NAAEAENVLLRQMDLLLTVATRHAGRITRSHGAL 
50 rhiet-YP061     33.9%  ----------------------M-PTEHLARRKHDRSGTYVCVRDHNHRGVETMADILTSLNPLRWIEAP--STELESQVTQSLFPMFQRLAEAGAETAKILQVALLRRVQVMCDSHSTR 
51 9rhob-b6yy40    36.0%  ----------------------M-------------------------------------------------QIELFTQ-------RTAQYFEALAQQNQFLQVANSRRSTRLMKDFQKK 
52 metsb-b8eis0    42.4%  ----------------------M--------------------------------------KPIAQSAGTLERFGL-AQ-------KSESLNRRLSDV-----TALSQSLQKLRSGHLAR 
53 legpa-q5x3d6    39.5%  ----------------------M-FAEIPKIQEQL--------------------------------------------------------------------HNVLEYSQSMTSLWMQS 
54 azovd-c1dif2    30.8%  ----------------------M-SQETFFAQQEDCFSSF---------------------------------------------------------------HNYVQHIGKLQKLQSDN 
55 pseu5-a4vhe6    34.3%  ----------------------M-SQESFFAKREDSFSSF---------------------------------------------------------------HNLFEHLSRLQQLHGKL 
56 9gamm-c6n5e9    38.6%  MG------------------YSM------------------------------------------------------------------------------------------------- 
57 legpn-Q8RNQ1    39.0%  ----------------------M------------------------------------------------------------------------------------------------- 
58 9rhob-a6e5f6    39.9%  ------------------------------------------------------------------------------------------------------------------------ 
59 9rhob-a9hui2    40.9%  ----------------------M------------------------------------------------------------------------------------------------- 
60 acide-c5t1r9    41.0%  ----------------------M-KTPTSPQKPRT-------------------------------------------------------------------SQRTTAGGKEAAVQGTHR 
61 acisj-a1w603    41.0%  ----------------------M-KIPTSPQKPRT-------------------------------------------------------------------SQRTTAVGKEAAVQWTHR 
62 aciet-b9mbf1    39.3%  ----------------------M-KAPTPTPKPQS-------------------------------------------------------------------SPSARPRRGKAAIQRVQR 
63 acisj-a1w9c9    36.4%  ----------------------M-KTPTSPAKPQT-------------------------------------------------------------------SQSARPQGRKAEIQKVQR 
64 burvg-a4jv42    39.3%  ----------------------M--------------------------------------------------------------------------------------SETAANQTRVG 
65 brasb-a5eul1    41.3%  ----------------------M--------------------------------------------------------------------------------------PTSIANQLARP 
66 metea-c5b1t3    38.3%  ----------------------M-KLRVAGEDAEL--------------------------------------------------------------------NSAMKLPSLAAAGTSPT 
67 meted-c7cfx5    39.1%  ----------------------M-DLPAPRPDAQA--------------------------------------------------------------------EGVMRAPASYTTGSSAE 
68 xanp2-a7ip61    37.6%  ----------------------M-YGRDTLAEP---------------------------------------------------------------------------MAGTAALGQS-- 
69 xanp2-a7iq18    37.1%  ----------------------M-YGRDTLAEP---------------------------------------------------------------------------MAGTAALGQS-- 
70 xanp2-a7ipv4    35.2%  MSRTWRIGIDISLALIGNEHVTM-TLQNGFSPP---------------------------------------------------------------------------AADTVSLSLET- 
71 rhopt-b3qg39    39.9%  ----------------------M-QFLHSSP-----------------------------------------------------------------------------VGSQAAPEAPT- 
72 ralp1-c6br16    35.6%  ----------------------M-TDRTVQRKR---------------------------------------------------------------------------RPARSAPGVAAP 
73 polna-a1vvx2    40.5%  M--------------------TM-TTKHLGAKH--------------------------------------------------------------------------AKAGMMADQLSPV 
74 desah-c0qhm8    37.2%  ----------------------M------------------------------------------------------------------------------------------------- 
75 lepcp-b1xwq8    36.8%  ----------------------M------------------------------------------------------------------------------------------------- 
76 azovd-c1djw3    20.5%  ------------------------------------------------------------------------------------------------------------------------ 
77 beii9-b2igq5    16.8%  ------------------------------------------------------------------------------------------------------------------------ 
78 burcc-b1k8j3    18.1%  ------------------------------------------------------------------------------------------------------------------------ 
79 burvi-q4bi33    17.8%  ------------------------------------------------------------------------------------------------------------------------ 
80 burvg-a4jv47    10.9%  ------------------------------------------------------------------------------------------------------------------------ 
81 metsb-b8ern6    13.5%  ------------------------------------------------------------------------------------------------------------------------ 
82 braja-BLL4548   12.1%  ------------------------------------------------------------------------------------------------------------------------ 
83 synww-q0axu9    11.1%  ----------------------M-N----------------------------------------------------------------------------------------------- 
   consensus/100%         ........................................................................................................................ 
   consensus/90%          ........................................................................................................................ 
   consensus/80%          ......................M................................................................................................. 
   consensus/70%          ......................M................................................................................................. 

 1 9burk-b1g6q9   100.0%  V------------RTASGV--------DRDTA-----AAPTT-----------RAP------TPWDTWSYGLDIIQRSVMFLDTLRERGTAYRERARQDPKPVLHFDYESVLDGR----Q 
 2 9burk-b5wax2    67.4%  V------------NDSLG----LDH--NDSAP-----ASSAP-----------APF------TALNAWQYTVDAAQRSLLFWDTLYRRGNEFVERSVSDPTPVLHFDYDMLLDGR----T 
 3 9burk-b5wqb7    65.1%  T------------SDAIK----GGD--GASAA-----TIPNP-----------AQF------TPWGAWHYTADFAQRSVLFWDTLRQRGNEFIERNKAGIKPALHFDYDVVLDAR----H 
 4 burs3-q391x0    67.5%  L------------SEAFD----GSDSPGHDPG-----AAPFA-----------TPL------SPLSAWHYAVDAVQRSVLFWDTLRERGTQYVERTAQGLKPVLHFDYDVVLDGR----Q 
 5 cupnh-q0k0q7    64.5%  V------------QQAVG---------EPGAG-----PINPM-----------AGM------DPMSSYAYAIDSMQRAILFWDTLRQRGNNFVENTMQGLKPVLHFGYETVLDAR----Q 
 6 cuptr-b3r4w6    64.6%  V------------RQAAD----------ASGG-----PAIQG-----------GGL------DPMSGYAYAVDSMQRAVLFWDTLRQRGNNFVENTMQGLRPVLHFGYETILDGR----K 
 7 cuppj-q472w1    63.6%  V------------QEATG---------GEAST-----PASWM-----------ADM------NPMNCYAYAIDSMQRAILFWDTIRQRGNNFVENAVQGLKPVLHFDYETVLDGR----S 
 8 azovd-c1dgm6    61.2%  ----------------------------ADAS-----ADPPA-----------PWT------LWNDWCRYGLDVAQRSILFWDTLRQRGDNYLEHVRQGQPPLLHFEHETVLDGR----T 
 9 metno-b8ihj3    46.9%  T---------------------EAANRAWIEA-----ARPLT-----------PAQ------AWGDAVTYWTDFAQRSLLFWDTLRQRGNNWLAHEAAGKPPLLAFGWEIVADAR----R 
10 mets4-b0umc8    45.9%  V---------------------QGANRAWIEA-----LTPRT-----------PAQ------AAGDAITYWTDFAQRSVLFWDTLRQRGNNWLAHEAAGKPPLLAFPYEVVADAR----R 
11 xanp2-a7ikd9    37.9%  M---------------------RGAASAFAAA-----CRPQD-----------PAS------AWRDTVSYTFDAAQRSLIFWDTMRQRGNNWIAHEKAGKPPLLAFDYETVADAR----T 
12 aroae-q5p962    32.4%  ---------------------NFPIPVPSAAT-----LPMMD-----------PFG------FARSAFDYWRDAVERSVLFMDVMRHRGNQYLEHIEKTKPSVLGFETEVLMDGR----E 
13 chrsd-q1qx98    37.1%  -----------------------MQAAWLDAA-----SPVLD-----------PFG------LMRATQAYWQDTFERSVLYWDVMRQRGNQYLEHMAQTRPNVLGFDAEVLIDGR----D 
14 borpd-a9hzm8    35.2%  -----------------------AVAVSASRS-----AQPAL-----------PSN------PWAAACEYAIDAMQRGVLYADVMRQRGNQYHSHMAKRAPNVLSMQSELVLDGR----E 
15 borpe-q7vzb4    34.5%  -----------------------APDRSPAPA-----AHP-------------AAN------LWTSAYQYTLDAWQRGILYTDVMRQRGNQYLTHMAKRAPNVLSMKSELVLDGR----K 
16 burp8-b2jmm5    35.0%  -----------------------LSGTFTAPT-----PFASM-----------PGN------LFAQGYAYAVDAWQRSVLFADVMRERGNQYHAHLQERVPNVLDFGAELVVDGR----T 
17 ralso-b5s536    35.4%  -------------------------------------SIGST-----------AGK------FLAEATAYAVDAWQRSVLFADVMRQRGNQYQAHLQERAPNVLDFGAKLILDGR----K 
18 burvg-a4js32    35.6%  --------------ETID-----QAAEAVESTCF---PFLRD-----------SLF------PWGAMSSYLADAWQRGILYADVMRERGNRYNAHLAEKVPNVLHFPCELILSGL----D 
19 comte-b7wqc8    31.9%  -----------------N--RDTTTSPAADWG-----QLLWD-----------PLR------LSAMATEYAVDAWQRSILYADVRRQRGNQYLEHLQEQTPNVLDFASEVIMSGL----D 
20 parl1-a7hyr7    36.3%  -----------------N--RDTTTSPTADWG-----QLLWD-----------PLR------LSAMASEYAVDAWQRSILYADVRRQRGNQYQEHLQEQTPNVLDFASEVIMSGL----D 
21 delas-a9brz2    33.6%  -----------------N--ENLQSHVTVDVG-----GMWGD-----------PMK------LSQAAAQYATDAWQRSLLYADIRRQRGNQYREHLAEEVPNVLSFRAEIVMSGL----D 
22 nitec-q0ajy0    34.3%  --------------------GGTADSPANSFG-----FFPAT-----------GLP------QVHAITEYAVDTWQRSVLYADVMRQRGNQYQAHLTEEVPNVLDFPSEVILSGQ----D 
23 comt2-d0j233    35.2%  -----------------------------------------------------------------------MDAAQRAVLYADIERQVGDQYRAQREARMPNVLHFPAELVMSGL----D 
24 comte-b7x1q8    33.0%  ----------------------SKPSEAGPST-----QGAVD-----------PLA------WWRVAAAYALDAAQRSVLYADIERQVGDQYRMQREARMPNVLHFPAELVMSGL----E 
25 beii9-b2iia7    35.6%  --------------------------SSTQEQ-----SPPISPLA--------LIG------LFAPAMGYFVDAAQRGILFLDVLRQRGNQYHEHIAKTAPHVLSYQAELVIDGR----Q 
26 braja-BLR3456   35.2%  --------------------------SMENPN-----LPGGP-----------LSG------LVASAVEYMVDASQRSVLFLDIMRQRGDQYREHVAQTAPHVLQYAAELIMDGR----K 
27 nithx-q1qpw8    35.6%  --------------------------SIDKAT-----LPGGA-----------LSG------FVASAVEYMMDAGQRNVLFMDVLRRRGDQYREHAAQTAPHVLHYAAELIVDGR----T 
28 rhime-yack      35.5%  --------------------------------------PEQSSIP--------TIP------TLSDAYTYALDAWQRSILFLDVMRQRGAQYEEHTAQTAPNVLDYEAELVCDGR----K 
29 rhisn-c3krv5    36.8%  --------------------------------------PKQS-----------TIP------TFADAFAYSLDAWQRSILFLDVMRQRGEQYDEHTAQTAPHVLDYDAELVVDGR----K 
30 brasb-a5eg29    36.4%  --------------------------SVGEDR-----AFGIA-----------PSN------PFVLAFAYLRDAAERSVLFWDVMRQRADEHRKRSLQTAPHVLDYAFEILRDGR----N 
31 azos1-d3p281    36.0%  -----------------------------------------------------MMD------LARQAQDYWIDASQRSILFLDVLRRRGNTHFEHGARTAPNVLGFSFEFVADGR----L 
32 beii9-b2icg9    36.5%  R----------------------AVPSPVFAL-----QGKSS-----------PATSWIDAFGLKPYQDYWQDAWQRSILFLDILRQRGDQYLERSQRDVPHVLSFGAELILDGR----T 
33 metsb-b8ert2    37.3%  P----------------------AGGAADESR-----GGSKA-----------GAS------AFGPAAEYWLDAWQRSILFLDVLRQRGDTYLERTTEIAPNVLSFKASLVMDGR----K 
34 azosb-a1k5s0    35.9%  Q---------------------LLPAAFAGIS-----GLFRH-----------QLH------TAAAAVHYLYDRWQRQILFIDVLRERGNQYIEHSRSGKPPVLAFDYEIIMDGR----R 
35 chrvo-q7nwh6    35.3%  -----------------------WSTAAVQGG---------------------KLP------FPQPLFDYWLDACQRGVLYWDTLYRRGATYLEHCESGKPPVLVFDYRIIMDGR----E 
36 chrvo-q7p1c7    36.6%  -------------------------AETDKGG---------------------WWS------WGQHWVDYWTDAAQRGLLFCDVLRERGDTYLEHQASGNPPVLVFDYDIIVDGR----E 
37 cupnh-q0kdv2    38.9%  T---------------------STATSLSAHA-----N---P-----------FAA------LAQPALEYALDAWQRTVLLLDILRQRGNESAEHELEGMPPVLVFEHELLADGR----Q 
38 cuppj-q475c4    38.4%  Q---------------------PESNGALAQF-----GAFAP-----------FFA------WPWAAVEYGVDAWQRSILLQDILRQRGNESTEHEREGMPPVLVFEHETLADAR----T 
39 ralme-q1lqx6    41.4%  P---------------------SPAATALAGF-----LPPVP-----------PTA------IAHAAWEYGLDAWQRSILFLDILRQRGNETAEHERGGMPPVLVFDYEVLIDGR----D 
40 acicj-a5ft95    35.2%  -----------------------GRGPAIAAG-----NAGPA-----------AVQ------LATAWPNYMIDAFQRSVLFLELLRQRGNDEIAITARPVATVLRFDHDLVMSGQ----A 
41 azoc5-a8ih86    33.7%  PW-----------SGVFA----EAWSRAFTGT-----APLPPGI---------GTL------PAGPLVDYLVDAAQRSVLFIDLMRRRGNEQQDITSRPMATVLSFDHDVLVSGR----A 
42 azosb-a1k696    41.1%  LD--------DLRVRLFA-----RARRLSQRWA----RQSSQ-----------RPP------SPAETLAYALDCTRRAVLLADTLRQRGNDFLDYEATGQPPLLAFDYEVLIDGR----Q 
43 9rhob-a0p290    35.6%  W------------QATVA-----EYGKAVKDM-----GGAQE-----------AGS------LYQAWEEYWQDATQRTVLTMDVLRQRGDNFMDHEEAGCPPVLIYDYEVVLDGA----D 
44 9rhob-b9r693    36.5%  W------------QLGLA-----DMGKAVEDL-----SKGQR-----------NGS------LFDAWQSYWKDAAQRAVLTMDVLRQRGDIFLEHEEAGCPPVLVYDYDVVMDGA----D 
45 meted-c7cnd9    37.5%  -----------------------------------------------------TGS------LSQDWAAYLHDRAERTVLTLDALRERGDIFIAHEGAGCPPVLIYDYEVVMDGR----D 
46 brasb-a5ef53    38.5%  A------------QDLIS-----EGAGLARSF-----SSAT------------QGH------IFDQARDYWIDAGQRMVLTLDVLRERADNDARHEAAGTPPVLIYDHEVALDGR----N 
47 braso-a4z1h1    38.2%  V------------QELIS-----EGAGLVQAF-----SAA-------------QAH------LLDHVNAYWIDAGQRMALTLDVLRERADNDAQHEAAGTPPVLIYDHEVALDGR----S 
48 rhop5-q07lt7    39.2%  L------------RERFE-----RTTSVMKEIA----GPSTD-----------GKG------WIDLASSYFTDSFQRTILTLDVLRERGNNDIAHEADGTPPVLIYKYEIAVDGA----K 
49 metsb-b8eqs6    37.0%  L------------HAAFE-----QAQALAAAA-----NAA-------------RAQ------LPQQLFDYWIDAAQRSALTIDVLRERANNDFAHEAAGTPPILIYDNETIVDGR----S 
50 rhiet-YP061     33.9%  Q------------GKLFT-----EAERLAESL-----REVHG-----------NGN------LGYAWAEYLRDASERAILCMDLLRQRGDIFLEHEAAGCPPVFFCDYETVMDGN----D 
51 9rhob-b6yy40    36.0%  Q------------EKSKI-----KGEALAASW-----APYDT-----------PKK------VMDAWTHYLKESSERAILTMDALRESSDTYFDHMAKGCPPVLVYDYEVIVEGR----N 
52 metsb-b8eis0    42.4%  I------------GAAQGEARKENAAKLREIW-----SPRRD-----------GAE------LLREFTDYAVDFAQRSVLFLDIMRDVGNAFNEQMAGERTPVLVYDYEMALDGR----K 
53 legpa-q5x3d6    39.5%  I------------DKSLE-----QTNKVTQSLINLNQQQIYP-----------YPN------ILNDAIEYTVDFMQRSILFWDIMRKRGNQYLKHEQEGQPPVLIFSYNMLMDGR----H 
54 azovd-c1dif2    30.8%  L------------QDGIR----RRQEKSLQKL-----TACAT-----------RQI------GPGDWLDYLSDFNQRTLLFWDTLRRRADGTLEHRRAGYPALLKFNYELLLDGR----D 
55 pseu5-a4vhe6    34.3%  M------------LDAFG----QRHAALLALL-----NEGRL-----------RAP------SPGDCWEYLVDCGQRGLLFWDALRQRGDNTLAHERAGYPLLLKFPYEVLIDGH----D 
56 9gamm-c6n5e9    38.6%  -------------------------------------EKQDT---------ELPYQ------IWRDFFSYQTDYWQRSILFLDTLRDRANNMMEHEQQGLPPLLDFKYELVLDGK----T 
57 legpn-Q8RNQ1    39.0%  -------------------------------------DKQDI---------DLPYQ------MGHDFISYQLDYWQRSILFWDTLRERANNMMEHEQQGLPPLLNFKYELVLDGK----S 
58 9rhob-a6e5f6    39.9%  -------------------------------------------------------------------MPYVQDAFERWVLLLDTLRERADNMIAHERQGMPPLLDFDYELLLDAR----T 
59 9rhob-a9hui2    40.9%  -------------NKSLR----LATVTPTQS------SQPVP-----------EQT------SAGANVPYAQDAFERWLLFLDTLRERADNMIAHDRLGMPPLLDFDYELLLDAR----T 
60 acide-c5t1r9    41.0%  QAEDLPPTVLDHSEELLK-----SAPQDASSG-----MKRAA-----------EAP------STQDYFDYQRDFFERTILFWDTLRQRANNMLEHERAGLPPLLDFKYETLLDAR----S 
61 acisj-a1w603    41.0%  QTKDLPPTVLDHSEELLK-----PAPQDASSG-----MKRAA-----------EAP------SAQDYFDYQRDFFERTVLFWDTLRQRANNMLEHERAGLPPLLDFKYETLLDAR----S 
62 aciet-b9mbf1    39.3%  LAEDLQPAVLDHSEELTK-----PAAQETSSG-----MKGAT-----------DAL------SAQDFFDYQRDFFERSIAFWDTLRQRANNMLEHERAGLPPLLDFKYETLLDAR----I 
63 acisj-a1w9c9    36.4%  PAEDLQPTILGHSEESMK-----PAAQEASSG-----MKRAT-----------EAL------SAQDFFDYQRDFFERSILFWDTLRQRANNMLEHERVGLPPLLDFKYETLLDAR----G 
64 burvg-a4jv42    39.3%  RSPSEPVT---------------CLPRAAQEG-----EVAEP-----------SAPALSD--PFRDPLDYLRDFCERSVLFWDTLRQRADRMIAHARVGKPPLLDFDYELLLDAR----R 
65 brasb-a5eul1    41.3%  EQFTSKTI---------------GPSSEGQAA-----NSVSN-----------TIP------SLSEFWDYQRDVWERTILFWDTLRERGDNALDHERMGLPPLLDFKYETILDAR----T 
66 metea-c5b1t3    38.3%  SATAASDIG--------------RFVSEASAE-----KAPGM---------RLPLG------SMQVLTAYQRDAWERTILFWDTLRARADNLLEHERLGLPPLLDFRSETILDAR----T 
67 meted-c7cfx5    39.1%  PGAEAPVIT--------------QPASKASPG-----EVSRM---------LLPSE------VLPDLIAYQCDAWERMILFWDTLRVRADNMLEHERLGLPPLLDFRSETILDAR----T 
68 xanp2-a7ip61    37.6%  ----------GPTGTGTP-----RQTRNAQGS-----AFSSD-----------PGT------FARDFLSYGRDVAERWILFWDTLRQRADNMLAHERAGKPALLDFDYEVLLDAR----R 
69 xanp2-a7iq18    37.1%  ----------GPTGTGAP-----QQTRNAQAG-----AFFSD-----------PGT------FARDVLSYGRDAAERWILFWDTLRQRADNMLAHERAGKPPLLDFDYEVLLDAR----R 
70 xanp2-a7ipv4    35.2%  -------ISFDSTSWGSA-----PVLRPTNRE-----MRVVD-----------PAR------LLQALFIYTQDSVERTILFWDTLRQRADNMLAHERAGKPALLDFDYDVLLDAR----Q 
71 rhopt-b3qg39    39.9%  -----------PNGDACG-----ANSQPTRAE---------------------ASD------AAPDLWTYSRDLLERSILFWDTLRQRADDLIEHERRGLPPLLDFRSETILDAR----Q 
72 ralp1-c6br16    35.6%  A-------------------LRLVSEPDHQAE-----PQPAP-----------AEP------PLEQGWDYWVDVTQRWILFIDILRQRANNMLAHEEAGLPPPLHFDYELLLDAR----T 
73 polna-a1vvx2    40.5%  AAMQTPPVA--------------PIMLTEQKE-----KAAVS-----------TAG------AWNDAWRYYVDSVQRSVLLLDVFRERGDNMLAHERAGQPPLLDFEHELVLDAR----Q 
74 desah-c0qhm8    37.2%  -----------------------EQHPVMEYP---------------------GSA------FFKDLWEYVDDAWQRGVLFMDTLRKRGNIYNEHLAQGNPPVLTFDYKIVMDGR----N 
75 lepcp-b1xwq8    36.8%  --------------------------------------------------------------RAVPGADYAQDAIERSVLFLDALRQRGNIYVEHVNAGEPDLLKFEHELVLDGR----D 
76 azovd-c1djw3    20.5%  ---------------------------MAESQ-----SPRGSGLSCASVPAFWPMT------MAAELAEKGLELYARNL---RFIQEEIRIHGE-----LRPSLATPNQVRLGLR----T 
77 beii9-b2igq5    16.8%  ---------------------------MEQTL-----SAPQKPESYLDLPFFWPFK------NVTNMTEEGLTLLKKNL---EFLAEEQKFKHG-----LEPHLATPNTIKLDLR----T 
78 burcc-b1k8j3    18.1%  ----------------------------MTAR-----DTPSPAVSAPALPIFWPMA------AAAAMFAAGAEIAARNL---RFLAEEEKLHFE-----AHPALASPNRPLLELR----T 
79 burvi-q4bi33    17.8%  ------------------------------MK-----STHRPAT--ASLPIFWPMA------AAATLFEAGSELTARNL---RFVAEEEKLHFG-----QRPALATENRPLLELR----T 
80 burvg-a4jv47    10.9%  ------------------------------------------------------MT------AAAQLVEQGVELYAKNL---AFLAEEEKLTYE-----LKPRLATANRVLLDLR----T 
81 metsb-b8ern6    13.5%  ---------------------------MTKNL-----PIEATANFENSVPFFWLLA------PWAKFGEEAAETFQRNI---DFAKEETKEEFE-----LKPVWATANEIVYELN----T 
82 braja-BLL4548   12.1%  --------------------------MAAKTG-----KQPGGPDHVPGDPLLWPFA------AARLAMDAWFGWMERGP---D------------EPADSSLPWTTPNTVALELA----T 
83 synww-q0axu9    11.1%  ---------------------WMDQP----------------------------------------------DLYSRYKIFLEILQSKEHISL------FDPRLKRYTDILIDLEKPFTT 
   consensus/100%         ........................................................................t..t+.....t....................h....p.hhth...... 
   consensus/90%          ..................................................................h.th..DhhpR.lhhhDhhppcup...t.......shL.h..chlhsut....p 
   consensus/80%          ................................................................t.hhtYhhDhhpRslLhhDhhRpRusphhtp.ttthsslLtath-hlhDu+....p 
   consensus/70%          .............................t........................h........htshhpYhhDshpRslLahDslRpRusphhtH.ttshPslLtaphEllhDuR....p 

 1 9burk-b1g6q9   100.0%  FERPVNYAL------LKIKPPEGV-IV---------------------DP-RKRPYLIIDPRAGHGPGIGGFKDDSQAGVALRGG--HPVYFLIFFPDPEPGQTLL--DVCAAEQQFVKR 
 2 9burk-b5wax2    67.4%  FERPVNYAL------LQLRPLEGV-GV---------------------DV-RKRPYLIIDPRAGHGPGIGGFKDDSQAGVALRAG--YPVYFVVFFRDPEPGQTLL--DVCNAEQRFVRK 
 3 9burk-b5wqb7    65.1%  FERPVNYAL------LSIRPREGV-VV---------------------DM-KKRPYLIIDPRAGHGPGIGGFKDDSQVGVALRAG--HPVYFVVFFQEPEPGQTLL--DVCAAEQQFVRK 
 4 burs3-q391x0    67.5%  FERPVNYAL------VHIQPPDGV-IV---------------------DA-AKRPYLIIDPRAGHGPGIGGFKDDSQVGVALRAG--HPVYFVVFFQEPEPGQTLL--DVCAAEQAFVRK 
 5 cupnh-q0k0q7    64.5%  FERPVNYAL------LKIIPPDGV-TI---------------------DD-SRRPYVIIDPRAGHGPGIGGFKDDSQVGVAMRAG--HPVYFVIFFRDPEPGQTLL--DVCEAEQQFIKR 
 6 cuptr-b3r4w6    64.6%  FERPVNYAL------LKITPPDGV-TI---------------------DD-SRRPYVIIDPRAGHGPGIGGFKDDSQVGVALRAG--HPVYFVIFFRDPEPGQTLL--DVCEAEQQFIKR 
 7 cuppj-q472w1    63.6%  FALPVNYAL------LKITPPASV-TV---------------------DD-NRRPYVIIDPRAGHGPGIGGFKDDSQVGVALRAG--HPVYFVMFFRDPEPGQTLL--DVCEAEQQFIRK 
 8 azovd-c1dgm6    61.2%  FARPVNYAL------LRILPPAGM-EA---------------------DP-RQRPYLIIDPRAGHGPGIGGFKDDSEVGVILRER--HPVYFVAFFRLPEPGQSLL--DVCAAEQVFVRK 
 9 metno-b8ihj3    46.9%  FERPANYAL------VRITAPPDV-HT---------------------DP-DKRPYVIIDPRAGHGPGIGGFKPESEVGMALRAG--HPVYMVIFFPDPVPGQTLA--DVARAEAEFLRI 
10 mets4-b0umc8    45.9%  FARPVNYAL------ARILPPPER-PS---------------------DA-EKRPYIIIDPRAGHGPGIGGFKPDSEVGMALRAG--HPVYVVIFFPEPVPGQTLA--DVAQAEAAFLRL 
11 xanp2-a7ikd9    37.9%  FARPANYAL------VRILPPAGV-TL---------------------DP-DKRPFLIIDPRAGHGPGIGGFKADSEVGFAMKAG--HAVYMVIFFPEPVPGQTLA--DVSLAEAELVRI 
12 aroae-q5p962    32.4%  LPRPVNYEL------MRVLPPAGI-EI---------------------DP-QRRPFVVVDPRAGHGPGIGGFKPDSEIGVALRAG--HPCYFVGFLPYPEPGQTVE--DVVEAEVAFLRC 
13 chrsd-q1qx98    37.1%  LPHPVNYEL------MRILPPEGV-TL---------------------DP-LKRPFVVVDPRAGHGPGIGGFKPDSEIGVAMRAG--HPCYFIGFLPFPMPGQHVE--DVVDAEIAFLRE 
14 borpd-a9hzm8    35.2%  FARPVNYGL------LRIVPPPGV-ET---------------------DP-QKRPFLVVDPRAGHGPGIGGFKPESEIGVAVNAG--HPCYFASFLPQPTVTQTVE--DVMRAEARFLEE 
15 borpe-q7vzb4    34.5%  FERPVNYAL------LRIVPPADA-PV---------------------DP-QKHPFLVVDPRAGHGPGIGGFKPESEIGVAVRAG--HPCYFATFLPHPTDTQTVE--DVMRAEARFLEE 
16 burp8-b2jmm5    35.0%  LPRPVNYGL------VRIAAPDDL-KPDRDLVEGR-------------DPGRLRPFVVVDPRAGHGPGIGGFKRDSEIGAALRAG--HPCYFVGFLPDPVPGQTVE--DVMLAEAAFLEK 
17 ralso-b5s536    35.4%  IPRPVNYGL------VRIDVPGDL-EPARDLTDGH-------------DPGRKRPFVVVDPRAGHGPGIGGFKRDSEIGAALRAG--HPCYFVGFLPDPVPGQTVE--DVMHAEAAFLEK 
18 burvg-a4js32    35.6%  LPKPVNYGL------VRILPHADA-PT---------------------DE-TKRPFVVVDPRAGHGPGIGGFKPDSEVGAALRAG--HPCYFVGFLPDPVPGQTVE--DVMRAEAAFLEK 
19 comte-b7wqc8    31.9%  LPRPVNYGL------VRILPPADT-PS---------------------DP-RKRPFVVVDPRAGHGPGIGGFKPDSEVGAALKAG--HPCYFVGFLPDPVPGQTVE--DVMRAEAAFVRK 
20 parl1-a7hyr7    36.3%  LPQPVNYGL------VRILPPADT-PS---------------------DP-HKRPFVVVDPRAGHGPGIGGFKPDSEVGAALKAG--HPCYFVGFLPDPVPGQTVE--DVMRAEAAFVRK 
21 delas-a9brz2    33.6%  LPRPVNYGL------ARIAPMEGT-VI---------------------DP-AKRPFIVVDPRAGHGPGIGGFKPDSEIGAALKAG--HPCYFVGFLPDPVPGQTVE--DVMRAEAQFVRK 
22 nitec-q0ajy0    34.3%  LPRPVNYWL------VRIVPPKDK-PT---------------------DN-MKRPFVVIDPRAGHGPGIGGFKVDSEIGVVIDAG--HPCYFIGFLPDPVPEQTIE--DVMHAQAAFMEK 
23 comt2-d0j233    35.2%  LPRPVNYGL------VRIQASEDR-PA---------------------DP-AKRPFVVIDPRAGHGPGIGGFKPHSEIGAALEAG--HPCYFVGFLPDPVPGQTVE--DVMRAEAAFMRR 
24 comte-b7x1q8    33.0%  LPRPVNYGL------VRIQAPENR-PA---------------------DP-GKRPFVVVDPRAGHGPGIGGFKPHSEIGAALEAG--HPCYFVGFLPDPVPGQTVE--DVMRAEAAFMRR 
25 beii9-b2iia7    35.6%  LVPPVNYAL------ARVIPPPNV-EL---------------------DP-TRRPFVVIDPRAGHGPGIGGFKADSEIGVAFKAG--HPCYFIGFLPDPVPGQTIE--DITQAEAIFLKK 
26 braja-BLR3456   35.2%  LDEPVNYAL------VRIIPPKDV-EI---------------------DL-KRRPFVVIDPRAGHGPGIGGFKADSEIGVAMKAG--HPCYFIGFLPEPMPGQTIE--RIARAEAIFIEK 
27 nithx-q1qpw8    35.6%  LDEPVNYAL------VRIIPPKDV-EI---------------------DL-DRRPFIVVDPRAGHGPGIGGFKADSEIGVAMKAG--HPCYFIGFLPEPMPGQTIE--RIARAEALFIEK 
28 rhime-yack      35.5%  LDRPVNYAL------VRIVPPAGA-VI---------------------DP-LKKPFVVVDPRAGHGPGIGGFKADSEIGVAIKAG--HACYFIGFLPEPVPGQTIE--DITRSEAIFLET 
29 rhisn-c3krv5    36.8%  LDKPVNYAL------ARIIPLAGI-AV---------------------DP-LKRPFVVVDPRAGHGPGIGGFKADSEIGVAMKAG--HPCYLIGFLPEPIPGQTIE--DIAGAEAIFLQT 
30 brasb-a5eg29    36.4%  FERPVNYAL------LRIVPPAGE-EI---------------------ST-TRRPFVVIDPRAGHGPGIGGFKADSEIGEALRAG--HPCYFVGFTADPMPGQTIE--DIVRAEAVFLEH 
31 azos1-d3p281    36.0%  LERPVNYGL------VRIVPPAGV-AV---------------------DD-RKRPFIVFDPRAGHGPGIGGMKQDSEIGVALKAG--HPCYFVGFLPDPLPGQTVE--DVCRAEAVFVEV 
32 beii9-b2icg9    36.5%  FERPVNYGL------VRIIPPQGV-TV---------------------DP-TKRPFIIFDPRAGHGPGIGGMKHDSEIGEVLKAG--HPCYFVGFLPQPVPGQTIE--DVCRAEALFVKK 
33 metsb-b8ert2    37.3%  LPRPVNYVL------ARITPPEGV-AT---------------------DP-AKRPFIVFDPRAGHGPGIGGMKAQSEIGQALAAG--HPCYFVGFLPKPEPGQTIE--DVCAAEARFVRE 
34 azosb-a1k5s0    35.9%  LPDPANYAL------ARIHPGPDCPPT---------------------DP-TRRPFVVIDPRAGHGPGIGGFKIDSGIGIALQQG--HPCYFVMFFPTPEPGQTIE--SVTRAEHAFLSR 
35 chrvo-q7nwh6    35.3%  LPDPANYAL------AAIVPPAACPPT---------------------DP-AKRPFVVIDPRAGHGPGIGGFKMDSEIGIALQQG--HPCYFVMFFPQPVPGQTIE--SVAKAEGHFLKR 
36 chrvo-q7p1c7    36.6%  LDEPVNYAL------AAIRPPANCPPT---------------------DP-GLRPFVVIDPRAGHGPGIGGFKMDSEIGIALRQG--HPCYFVMFFPVPVPGQTIE--CVWRAEKAFLHK 
37 cupnh-q0kdv2    38.9%  LPEPANYAL------LRIVPPADS-PT---------------------DP-ALRPFVVIDPRAGHGPGIGGFKADSEIGIALRTG--HPCYFITFFYEPCPGQTIE--SVARAEAAFLQI 
38 cuppj-q475c4    38.4%  LPEPVNYAL------LRIIPPADM-PT---------------------DP-AKRPFVVIDPRAGHGPGIGGFKADSEIGIALRMG--HPCYFITFFRDPCPGQTIE--AVARAEAGFMKI 
39 ralme-q1lqx6    41.4%  LPTPVNYAL------VRIVPPEGQ-PT---------------------DP-AKRPFVVMDPRAGHGPGIGGFKSDSEIGNALRSG--HPCYFITFFRDPCPGQTIE--DVARTEGLFLQA 
40 acicj-a5ft95    35.2%  LPRPMNYSL------LRITPPPGV-IT---------------------DL-RKRPVVVVDPRAGQGPGIGGFKAESEIGDALDAG--HPVYFISFAATPEPGQQFL--DVVEGQVAFFER 
41 azoc5-a8ih86    33.7%  LPRPINYFL------SRIVPPPGA-KV---------------------DP-DKRPVVVVDPRAGQGPGIGGFKTQSEIGEALANG--HPVYFIGFSAQPEPGQTFL--DVVEGQVSFFER 
42 azosb-a1k696    41.1%  LPRPVNYCL------VRIVPPDGV-EV---------------------DE-TKRPYLIIDPRAGHGAGIGGFKQESQVGVALQAG--NPVYFAVFYPEPEPGQTLA--CVAAAQLRFVRE 
43 9rhob-a0p290    35.6%  LPRPSCYML------LKIIPPADL-PCRDP------------------KP-FKRPYIIIDPRAGHGAGIGGFKPDSQVGVALHDG--HPVYFVAFKRMPEKGQTLA--DVTHAEAAFVRK 
44 9rhob-b9r693    36.5%  LPRPCCYQL------LRIKAPEDG-EHREI------------------KP-WKRPYVIIDPRAGHGAGIGGFKPDSQVGVALRDG--HPVYFIAFKRMPEKGQTLA--DVTLAEAAFVRR 
45 meted-c7cnd9    37.5%  LPRPCNYML------LRIVPPAGV-TV---------------------AD-SKRPYVIIDPRAGHGAGIGGFKFDSQVGVALARG--NPVYFVGFRRDPESGQTLA--DVARAEAAFVRE 
46 brasb-a5ef53    38.5%  LVRPVNYML------LKILPPAGV-VT---------------------YD-WKRPYVIIDPRAGHGAGIGGFKQDSQVGVALHDG--HPVYFVVFRPHPEPTQTLA--DVMRAEAAFIAE 
47 braso-a4z1h1    38.2%  LPRPVNYML------LKILPPAGV-VT---------------------YE-WKRPYVIIDPRAGHGAGIGGFKQDSQVGVALHDG--HQVYFVVFRPHPEPTQTLA--DVMRAEAEFIAE 
48 rhop5-q07lt7    39.2%  LKRPVNYML------LKILPPEGI-EI---------------------FD-WKRPYMIIDPRAGHGAGIGGFKEDSQVGVALRDG--HPVYFVAFRPHPEPGQTLA--DVMRAEVEFIRE 
49 metsb-b8eqs6    37.0%  LKRPVNYVL------LKILPPPGV-KI---------------------LD-WKRPYMIIDPRAGHGAGIGGSKHDSQVGVALADG--HPVYFVAFRPHPEPGQTLA--DVMRAEAEFVKE 
50 rhiet-YP061     33.9%  LPLKSNYVL------LRMIPPQGV-NV---------------------DD-TKRPFIIICPRAGHSPGVGGHKEDSQVGVAFREG--HPVYLVSFRREPEGGQYLS--NVTYAEAAFVRE 
51 9rhob-b6yy40    36.0%  LPRPCNYML------LKIIPPEGT-EV---------------------FD-WKRPYVIIDPRAGHGAGIGGFKDDSQVGVALRGG--HPVYFVAFHPMPEPHQELS--HVTHAEAAFLRE 
52 metsb-b8eis0    42.4%  MSRPVNYAL------VRIIPPEGT-PV---------------------DP-MRRPFMIIDPRAGHGPGIGGFKLDSEVGVALAHG--HAVYFVIFFPDPEPGQTLA--DVCAAEGLFVRE 
53 legpa-q5x3d6    39.5%  FERPVNYAL------VEIIPPEGI-QI---------------------DP-AKRPYVIVDPRAGHGAGISGFKDASQVGLALRAG--HPVYVIIFFPVPEPHQTLV--DVTAAHEKFLTE 
54 azovd-c1dif2    30.8%  LPAPVNYSL------LHILPGPSQ-TT---------------------DP-SLPPVIVIDPRGGHGAGIGGFKEDSEIGESLRAG--HPTYFISFSHSSEPGQTLS--DIALAEARFIEL 
55 pseu5-a4vhe6    34.3%  LPHPVNYSL------LRILPTADQ-PS---------------------DA-TRQPVIVIDPRGGHGAGIGGFKQDSEIGESLRAG--HPTYFIAFSHAPVPGQTLL--DIAAAEARYIEA 
56 9gamm-c6n5e9    38.6%  LEPKTNYAL------VKILEIGDV-CFDKCF-----------------DP-TAAPVIVVDPRAGHGPGIGGFKRDSEIGIALHTG--HPVYFVIFYPEPIPHQTLA--DVLVTMRHFVEK 
57 legpn-Q8RNQ1    39.0%  LEPKTNYAL------VKILEVGDV-CFEECF-----------------DP-HAHPVIIVDPRSGHGPGIGGFKRDSEVGIALHSG--HPVYFVIFYPNPVPHQTLA--DVLMTLRHFVEK 
58 9rhob-a6e5f6    39.9%  FERSANYAL------LRITRVGDD-CWDDCV-----------------DE-AKPPVIVIDPRAGHGPGIGGFKRDSEVGMAMHEG--HPVYFVIFYPEPMPGQTLS--DVHYALRDFVLE 
59 9rhob-a9hui2    40.9%  FVRPANYAL------LWITRVGDD-CWEDCV-----------------DE-AKPPVIVIDPRAGHGPGIGGFKHDSEVGMAMHEG--HPVYFVIFFLEPVPGQTLA--DVHYALRDFVTE 
60 acide-c5t1r9    41.0%  FDRPVNYAL------LRITEIDGH-CWEDCV-----------------DS-DKPPVIIVDPRAGHGPGIGGFKRDSEVGMAMREG--HPVYFVIFFPEPALGQTLA--DVLHVLRRFVEE 
61 acisj-a1w603    41.0%  FERSVNYAL------LRITEIDGH-CWDDCV-----------------DS-DKPPVIIVDPRAGHGPGIGGFKRDSEVGMAMREG--HPVYFVIFFPEPTLGQTLA--DVLHVLRRFAEE 
62 aciet-b9mbf1    39.3%  FERPVNYAL------LRITEIDEH-CWDDCV-----------------DP-DKPPVIVVDPRAGHGPGIGGFKRDSEVGMAMREG--HPVYFVIFFPEPALGQTLA--DVLHVLRRFVEE 
63 acisj-a1w9c9    36.4%  FERPVNYAL------LRITEIDEH-CWDDCV-----------------DP-DKPPVIVVDPRAGHGPGIGGFKRDSEVGMAMREG--HPVYFVIFFPEPALGQTLA--DVLHVLRRFVEE 
64 burvg-a4jv42    39.3%  FEHPANYAL------VRITRAGDV-CFDECL-----------------DE-SKPPVIVVDPRAGHGPGIGGFKRDSEVGMAMHEG--HTVYFVMFFPEPCPDQTLV--DVLHSLRRFVEE 
65 brasb-a5eul1    41.3%  FTRPVNYVL------LRILPPESA-SERHCT-----------------VL-DRPPVIVVDPRAGHGPSIGGFKHDSEAGVALDEG--YPVYFVSFFPEPCQGQTLA--DVLHTLRRFVEA 
66 metea-c5b1t3    38.3%  FERPANYAL------LRIVAAEAA-EADCCV-----------------DE-AKPPVIVIDPRAGHGPGIGGFKRESEVGMALKEG--HTVYFVIFFPEPCRNQTLA--DVLYALRRFVEA 
67 meted-c7cfx5    39.1%  FERPANYAL------LRIVEAEAA-EAACCV-----------------DE-EKPPVVVLDPRAGHGPGIGGFKRESEVGMALKEG--HPVYFIIFFPEPCRGQTLA--DVLHALRRFVEA 
68 xanp2-a7ip61    37.6%  LERPANYAL------LRVTRVGDE-CLEDCL-----------------DA-AKPPVVILDPRAGHGPGIGGFKQDSEVGIALHQG--HPVYFVTFYPEPAAGQTLA--DVLHVLRRFVEE 
69 xanp2-a7iq18    37.1%  FERPANYAL------LRVTRVGDQ-CLDACL-----------------DA-AKPPVVILDPRAGHGPGIGGFRQDSEVGLALHQG--HPVYFVTFYPEPAAGQTLA--DVLHVLRRFVEE 
70 xanp2-a7ipv4    35.2%  FEHPANYAL------LRVTRVGDE-CLEDCL-----------------DA-SKPPVVILDPRAGHGPGIGGFRQESEVGVALHQG--HPVYFVTFFPEPAPGQTLA--DVLHALRRFIEE 
71 rhopt-b3qg39    39.9%  FAHPVNYVL------LRIFAEDAP-TI-TPS-----------------DE-QKSPVLVIDPRAGHGPGIGGFKKDSEVGIALAEG--YPVYFVSFFPEPCRGQTLA--DVLHALRHFVQA 
72 ralp1-c6br16    35.6%  FERPANYAL------LRITRCGTD-HLERQV-----------------RA-DATPVIVIDPRAGHGPGIGGFKRDSEVGMALAEG--HPVYFVSFFPAPCRGQTLG--DVLNALRTFVEE 
73 polna-a1vvx2    40.5%  FDRPANYAL------LRITRCGPT-HASNFE-----------------RQ-DLRPVIVIDPRAGHGPGIGGFKHDSEVGVALHEG--HPTYFAMFYPEPCPGQTLA--DVIHALRMFVEE 
74 desah-c0qhm8    37.2%  FEKPVNFTL------ARIINRRHQ-PVFKANDDKERRAVQVDQETRTSTS-IRRPIVILDPRAGHGPGIGGSKRDSEIGIALTLG--HPVYFILFFPEPEPGQTLA--DVQRTQVRFLQE 
75 lepcp-b1xwq8    36.8%  LPRPCNYAL------LHILQPADA-PL---------------------DP-LARPVMVVDPRAGHGPGIGGFKHDSEVGMALRAG--HPVYFVTFRPQPEEGQTLL--DVAVAEARFLET 
76 azovd-c1djw3    20.5%  M-------F------LRDY---GR------------------------PG-EGIPTLVDAPYAGHTAMIADYHAGQSLVETLLANGIGHVALTDWKSATEDMKDFEIDNYLGELVVAIDD 
77 beii9-b2igq5    16.8%  V-------R------FRDY--SKP------------------------DA-TGIPTIVDAPFAGHSAMIADYHKGQSLMETLAANGIDNLYLFDWKSATLDMKDLEIDQYLAEINVCVDD 
78 burcc-b1k8j3    18.1%  M-------T------FRDY--SAA------------------------PA-HGLPTIVDAPYAGHSAMIADYQPGQSLMQTLREHGVTRVYLTDWRSATEDMKDLEIDQYLAELNVCVDE 
79 burvi-q4bi33    17.8%  M-------I------FRDY--STA------------------------QP-QGLPTIVDAPYAGHSAMIADYQPGQSLMQTLREHGVTRLYLTDWRSATEDMKDLEIDQYLAELNVCVDE 
80 burvg-a4jv47    10.9%  M-------V------FRDYSDSAQ------------------------AA-SGVPTIVDAPYAGHTAMIADYHAGQSLIETLLANGLHRVFLTDWKSATEDMKDLEIDQYLAEINVCVDD 
81 metsb-b8ern6    13.5%  M-------W------LRDFSDAAA-RG---------------------DS-SIIPTLIDPPYAGHHSTIADYAEGQSLVETLQASGLRRLLCIDWKSASAEMKDYNIDIYLAEINAVVDD 
82 braja-BLL4548   12.1%  M-------H------LRD-----C-TK---------------------DR-SGQPALVCAPYALHRALIADFAPGHSVVQSLQNGGIDRVYLTDWRSATPDMRYLSIDSYLADLNVAIDE 
83 synww-q0axu9    11.1%  WSTPNHIILVHKTLCLRHFPNKY--------E----------------SS-AKRPVLILPPQAGHHSNLADYSPAQSLVRVFHRYG-YDVYVTQWLSATTEYKDLGIEDYIRLTDEAVEE 
   consensus/100%         h.......h.............................................Phhl.sP.uhpts.lus.t.tpthh..h.......hhhh.a...s...p.h....h......hh.. 
   consensus/90%          h....sa.L......h+hh...s.........................t...t.PhllhsPRAGHusuIuGa+.tSplG.shttG..assYhh.Fh.ts..tQsl...slh.s.t.hlpt 
   consensus/80%          h.cPsNYhL......l+Ih..tsh..h.....................cs.tp.PhlllDPRAGHGsGIGGFK.-SplGhAlptG..HPsYFlhFh.tP.ssQTlt..cVhts.thFlcp 
   consensus/70%          h.+PsNYsL......lRIhsstsh..h.....................Ds.t+pPhlllDPRAGHGPGIGGFKtDSplGhAL+tG..HPsYFlhFhspP.sGQTlt..DVhtA.ttFlcc 

 1 9burk-b1g6q9   100.0%  LRTLHPDS-PKPALVGNCQGGWAAMMIAASDPDDTG-PIVINGAPMSYWSGAWSEGQGDNPMRYAGGILGGSWLASFAADLGAGKFDGAHLVQNFESLNPANTLWDKYYHLFHNVDTEP- 
 2 9burk-b5wax2    67.4%  VRSLHPDS-PRPAIIGNCQGGWAAMMLASSDPDETG-PIVINGAPMSYWSAAWSEGEGDNPMRYAGGMLGGSWLASYAADLGNGKFDGAYLVQNFENLNPANTFWDKYYHLYSNVDTEP- 
 3 9burk-b5wqb7    65.1%  VRELHSDS-PKPAIVGNCQGGWAAMMLASSSPEDTG-PILVNGAPMSYWSGAWSESEAPNPMRYAGGILGGTWLSSLSADLGNGKFDGAHLVSNFEYLNPANTFWDKYYNLFANIDTEP- 
 4 burs3-q391x0    67.5%  VRALHPDS-LKPAIVGNCQGGWAAMMLASSSADDTG-PIVINGAPMSYWSGAWSEGPGDNPMRYAGGLLGGTWLASFSSDLGNGKFDGAYLVQNFENLNPANTLWDKYYHVYDNIDTEP- 
 5 cupnh-q0k0q7    64.5%  VRELHPHS-AKPAIIGNCQGGWAAMMLGASDPGDTG-PIVINGAPMSYWSGAWSEGEGDNPMRYSGGLLGGTWLASYTADLGNGKFDGAWLVQNFENLNPSNSLWDKYYNLYKKADTEP- 
 6 cuptr-b3r4w6    64.6%  VRALHPHS-AKPAIIGNCQGGWAAMMLGASDPDDTG-PIVINGAPMSYWSGAWSEGEGDNPMRYSGGLLGGTWLASYTADLGNGKFDGAWLVQNFENLNPANSLWDKYYNLYRKVDTEP- 
 7 cuppj-q472w1    63.6%  VRALHPDS-PKPAIIGNCQGGWAAMMLAASDPDDTG-PIVINGAPMSYWSGAWSEGEGDNPMRYSGGLLGGTWLASLTADLGNGKFDGAWLVQNFENLNPANSLWDKYYNLYRKADTEP- 
 8 azovd-c1dgm6    61.2%  VRELHPDS-PKPALVGNCQGGWATMMLAATDPDSAG-PVVINGAPMSYWGGAWREGEGDNPMRYAGGLLGGTWLASLASDLGNGLFDGAHLVENFENLNPANTYWDKYYHLFANIDGEP- 
 9 metno-b8ihj3    46.9%  VRERHPTR-GKPVIVGNCQGGWAAMLVGALDPDCAG-PIVVNGAPMSYWAGN----DAENPMRYAGGMLGGSWTALLASDLGGGQFDGAYLVDNFEYLNPANTYFGKAYNLFAKIDTEP- 
10 mets4-b0umc8    45.9%  VRERHPTR-GKPVIVGNCQGGWAAMLVGALDPEGAG-PIVVNGAPMSYWAGN----DAENPMRYAGGMLGGSWTALLASDLGGGVFDGAHLVDNFEYLNPANTWFGKSYNLFSKIDTEP- 
11 xanp2-a7ikd9    37.9%  VRGRHPTC-DKPVVMGNCQGGWAAMLVAALDPDNVG-PIVVNGAPMSYWAGN----DAENPMRYAGGVLGGAWTASLAADLGGGVFDGAYLVDNFEYLNPANTYFGKYYTLYSRIDTEP- 
12 aroae-q5p962    32.4%  VIERHPTTAEKPMVVGNCQAGWQIMMAAALEPDLFG-PILIAGSPLSYWAGE----RGKAPLRYTGGLSGGSWMTALLSDLGNGLFDGAWLVQNFENLNPANTWWTKQYRVFANVDTEA- 
13 chrsd-q1qx98    37.1%  VGARH--AGEKPVVIGNCQAGWQLMMAAALAPDAFG-PILIAGAPLSYWAGE----RGRYPMRYTGGLLGGSWLTALAGDLGAGLFDGAWLVQNFERLNPANTLWAKQYRLYADVDDES- 
14 borpd-a9hzm8    35.2%  IIARHPESEGKPVVVGNCQAGWQIMMTAAMRPELFG-PIIVAGAPLSYWAGW----RGMNPMRYSGGLTGGSWLTELASDLGHGRFDGAWLVQNFENLNPANTLWSKQYHLYSKVDTEA- 
15 borpe-q7vzb4    34.5%  IIALHPQAEGRPVVVGNCQAGWQIMMTAAMRPELFG-PIIVAGAPLSYWAGW----RDMNPMRYSGGLLGGSWLTQMTSDLGNGKFDGAWLVQNFENLNPANTLWSKQYNLYAKVDTEA- 
16 burp8-b2jmm5    35.0%  VIELHPDSPGKPAVIANCQAGWQVLMTASMRPDLFG-PIVVAGAPVSYWAGW----RGKNPMRYSGGMLGGSWLTALTGDLGDGRFDGAWLVENFENLNPANTLWTKQYNLYANIDTEG- 
17 ralso-b5s536    35.4%  VIELHPDSPGKPAVIGNCQAGWQVLMTAAMRPDLFG-PIIVAGAPVSYWQGW----RGKNPMRYSGGLLGGSWLTALTSDLGDGRFDGAWLVQNFENLNPANTLWSKQYNLYANIDTEA- 
18 burvg-a4js32    35.6%  VIERHPDSQGKPAVIGNCQAGWQILMTAAMRPELFG-PIIVAGSPVSYWAGW----KGRNPMRYAGGLLGGSWLTALTSDLGAGRFDGAWLVQNFENLNPANTLWTKQYNLYSKVDTEA- 
19 comte-b7wqc8    31.9%  VGELHPGSRGKPAVIGNCQAGWQILMAAAVWPELFG-PIIVAGAPLSYWA-------GDMPMRYAGGLTGGSWLTALTGDLGAGRFDGAWLVQNFENLDPANTLWSKQYNLYAKVDTEG- 
20 parl1-a7hyr7    36.3%  VGELHPDSRGKPAVIGNCQAGWQILMAAAVWPELFG-PIIVAGAPLSYWA-------GDMPMRYAGGLTGGSWLTALTSDLGAGRFDGAWLVQNFENLDPANTLWSKQYNLYAKVDTEG- 
21 delas-a9brz2    33.6%  VAELHPESRGKPAVIGNCQAGWQILMTAAVWPELFG-PIIVAGAPLSYWA-------GDNPMRYGGGLMGGSWMTALTSDLGAGRFDGAWLVQNFENLNPANTLWEKQYQVYADVDTEG- 
22 nitec-q0ajy0    34.3%  VLALHPCREGKPAVIGNCQAGWQILMTAAMRPELFG-PIIVAGAPLSYWAGW----RGRDPMRYTAGLLGGSWLTALTSDIGGGRFDGAWLVQNFENLNPANTLWNKQYHLYSNIDTEA- 
23 comt2-d0j233    35.2%  VAELHPESEGKPAVIGNCQAGWQILMTAAVWPELFG-PIIVAGAPLSYWA-------GDNPMRYSGGLLGGSWMTALASDLGHGRFDGAHLVQNFEQLDPANTLWSKQYKVYANVDTEA- 
24 comte-b7x1q8    33.0%  VAELHPGSEGKPAVIGNCQAGWQILMTAAVWPELFG-PIIVAGAPLSYWA-------GDNPMRYSGGLLGGSWMTALASDLGNGRFDGAHLVQNFEQLDPANTLWSKQYKVYANVDTEA- 
25 beii9-b2iia7    35.6%  VIDLHPEADGKPCVIGNCQAGWAVMMLAALYPELFG-PIIVAGSPLSYWAGV----RGRNPMRYSGGLLGGSWLTALTSDLGNGKFDGAWLVQNFENQNPANTLWTKQYNLYSKIDTEP- 
26 braja-BLR3456   35.2%  VISRHPDADGKPCVIGNCQAGWAVMILASLRPELFG-PLIIAGAPLAYWAGV----HGKYPMRYSGGLLGGSWLTALTSDLGAGKFDGAWLVQNFENQNPSNTLWTKQYNVYSKVDTEA- 
27 nithx-q1qpw8    35.6%  VISLHPKADGKPCVIGNCQAGWAVMILASLRPELFG-PTIIAGAPLAYWAGV----HGKYPMRYSGGLLGGSWLTALTSDLGAGKFDGAWLVQNFESQNPSNTLWTKQYNVYSKVDTEA- 
28 rhime-yack      35.5%  VIARHPDADGKPCVIGNCQAGWAVMILASLRPELFG-PIIIAGAPLSYWAGI----RGQYPMRYSGGLLGGSWLTALTGDLGAGIFDGAWLVQNFENQNPANTLWTKQYNLYSKVDTEA- 
29 rhisn-c3krv5    36.8%  VIARHPDADGKPCVVGNCQAGWAVMILAALRPELFG-PIIIAGTPLSYWAGV----RGQYPMRYSGGLLGGSWLTALTSDLGAGIFDGAWLVQNFENQNPANTLWTKQYNLYSNIDTEA- 
30 brasb-a5eg29    36.4%  VISLHPDADGKPCVIGNCQAGWAVMILAALRPELFG-PIIIAGAPLSYWAGV----RGRNPMRYSAGLLGGSWLTAFTSDMGDGKFDGSWLVQNFENQNPANTLWSKQYNVYSKIDTEA- 
31 azos1-d3p281    36.0%  VARLHPDADGKPCLIGNCQAGWQIAMMAATHPDRVG-PLLLAGAPLNYWAGV----HGKNPLRYLGGLLGGTWQTALAGDLGAGIFDGAALVANFERMNPANTLWKKGYNVYSKIDTEE- 
32 beii9-b2icg9    36.5%  VAELHPDSDRKPTLIGNCQAGWQIAMMSALNPDLPG-PLLLAGAPLSYWAGV----HGRNPLRYLGGLLGGTWMTTLAGDLGNGIFDGAALVANFERMNPANTYWKKNYNVYSKVDSEA- 
33 metsb-b8ert2    37.3%  VAELHPQAEAKPCLIGNCQAGWQIAMTAAVDPAPVG-ALILAGAPLSYWAGV----HGKNPLRYLGGLLGGTWLTALSGDLGAGIFDGASLVENFERMNPANTYWKKPYNVYSKIDTEA- 
34 azosb-a1k5s0    35.9%  VNELHPEA-SQPLVIGNCQGGWALMMLAASAPRVVG-PILLAGSPVSYWAGV----RGKNPMRYTGGLMGGTWLASLVGDLGNGRFDGALLVNNFELLNPANTFWGKPYGLFANVDEER- 
35 chrvo-q7nwh6    35.3%  VNELHPDSDGKPFVIGNCQGGWALAMLASVAPELVG-PILLAGSPLSYWAGV----RGKNPMRYAGGLTGGTWTASLAGDLGNGHFDGAHLVENFEKLDPANTLWKKSYNLYAKVDTEP- 
36 chrvo-q7p1c7    36.6%  VREMHPGNAGKPFAIGNCQGGWALAMVAASAPEDVG-PILLAGSPLSYWAGV----AGKNPMRYQGGMLGGTWLASLTGDLGHGQFDGAHLVSNFEQLDPANTYWKKGYHLYANIDKER- 
37 cupnh-q0kdv2    38.9%  VGERHPDAPGKPFIIGNCQAGWALMMLAAVAPERTG-PLLLAGAPLAYWSGV----RGRNPMRYSGGLLGGSWLASLIADLGNGRFDGAWLVENFEQLNPANTLWEKLYDVYAKADTEG- 
38 cuppj-q475c4    38.4%  INERHPDAPGKPFVVGNCQAGWALMILAAVAPDAVG-PLLVAGAPLSYWAGV----RGTNPMRYSGGLLGGSWLASLTADLGNGRFDGAWLVQNFEQLNPSNTLWGKLYNVYAKADTEG- 
39 ralme-q1lqx6    41.4%  VAERHPDAPGKPFVVGNCQAGWALLMLAAAAPEVTG-PILLAGAPVAYWSGV----RGKNPMRYSGGLLGGTWLASLAADLGNGRFDGAWLVQNFEKLDPANTFWSKLYNVYAKADTEG- 
40 acicj-a5ft95    35.2%  VVALHPGA-PRPFAIGNCQAGYQTLMVAMLRPDLFG-PCLVAGSPMSYWQGV----HGKYPMRYAGGLLGGSWLTAMSSDLGRGRFDGTALVMNFDSLNPANWLWGKQYDVYTHIDTGG- 
41 azoc5-a8ih86    33.7%  IVAMHPDA-PRPFAIGNCQAGYQTLMVAMLRPDLFG-PCMVAGSPMSYWQGV----HGKNPMRYSGGLLGGSWLTALVSDLGRGKFDGTWLILNFDSLNPANWLWGKQYDLYAAVDTEA- 
42 azosb-a1k696    41.1%  VAARHPRS-PKPALVGNCQGGWAVMALAAVDPGIAG-PVVLNGAPLSYWAGV----RGRDPMRYLGGLAGGSWPSYLLGDLGHGHFDGAWLVQNFEGLNPANTVWTKYYRVFRGGEEEA- 
43 9rhob-a0p290    35.6%  VMELHPEA-PNPVVTGNCQGGWATLLLAAMNPDLTG-PIILNGAPVSTWSGR----VGENPMRYNAGVLGGTWNAMYYSDLGHGIFDGADIVQNFEMLNPARNYFGKYYDLYSKVDTEP- 
44 9rhob-b9r693    36.5%  IMEEHPDA-PNPIITGNCQGGWATLLLAATNPDLTG-PVVLNGAPVSTWAGR----VGENPMRYNGGILGGTYNAMFYSDLGHGVFDGADIVQNFEMLNPARNYFGKYYDLYSKVDTEP- 
45 meted-c7cnd9    37.5%  VVRRHPES-PMPAIIGNCQGGWAALLLAATNPDLSG-PVVLNGAPVAAWSGE----VGTNPMRYKAGLIGGTWQSMFWSDIGGGVFDGAHLVNNFELLNPSRHYFVKYYDLFTSIDIGR- 
46 brasb-a5ef53    38.5%  VHRRHPEA-PKPIIVGNCQGGWATLILAAANPDITG-PLVVNGAPVASWSGR----LGENPMRYNGGLLGGILPALVLSDLGGGEFDGVHLVSNFEMLNPGRNYFGKYFDLYADPEKGR- 
47 braso-a4z1h1    38.2%  VHRRHPEA-PKPIIVGNCQGGWATLILAAANPDITG-PLVVNGAPVAYWSGR----LGENPMRYNGGLLGGILPALLLSDLGGGEFDGVHLVSNFEMLNPGRNYFGKYFDLYTSPEKGR- 
48 rhop5-q07lt7    39.2%  IGRLHPNA-PKPIVVGNCQGGWAALLLAAANSDITG-PLVINGAPVAYWSGR----VGENPMRYNGGLLGGVVPALLFSDLGHGQFDGAHLVSNFEGLNPSRNHWGKYFDLYSDVEGGR- 
49 metsb-b8eqs6    37.0%  IARRHPQS-PKPIIVGNCQGGWAATILAAANPDISG-PLVINGAPISAWSGR----VGEDPMRYRAGLNGGVATPLLLSDLGHGEFDGAYLVANFEALNPSRHHWTKYYDLYANVDANR- 
50 rhiet-YP061     33.9%  VMRLHPLA-RLPVVVGNCQAGWATLLMVATNLDLAG-PIILNGSPVTPTSGN----IGENTLRYMAGLFGGAWITMFLSDLGGGIFDGAHLVQNFETLNPERQLFMKYVELFRDVDAAS- 
51 9rhob-b6yy40    36.0%  IIARHPDS-PKPIVVGNCQGGWATAILAAVYPDLVG-PIVLNGAPMSYWSGK----MGQDPMRYSAGLTGGIVPALLSADLGNGVFDGANLVQNFEMLNPGRNWFRKYYDLYTTIDSGE- 
52 metsb-b8eis0    42.4%  VSRRHPGA-DKPAILGNCQGGWAAALVAASNPYVTG-PIVLNGAPLSYWAGE----RGKNPLRYKGGLKGGAMPVLLLSDLGNGRFDGANLVFNFESMNPGNTWWSKYYNVFANVDSEG- 
53 legpa-q5x3d6    39.5%  VALRHPQS-PKPCLIGNCQGGWAILTLMAANPDVAG-VAVVNGAPLSYWGGE----NGKNPMRYIGGIWGGSWIAQMAGDLGNGKFDGANLVMNFEMANPKVTYWSKYYNLFANLDKEE- 
54 azovd-c1dif2    30.8%  VSERHAHA-GKPVLIGNCQAGWALMGLAALRPELPG-LLIVVGAPLSYWAGV----NGRNPMRYAGGLLGGAWMTRLGSDLGNGRFDGTWLVNNFENLDPAHALWGKYYDLFSSVDSEA- 
55 pseu5-a4vhe6    34.3%  VSARHPEA-GKPVVIGNCQAGWALMGLAAARPELPG-LVIVNGAPLSYWAGV----NGRNPMRYAGGLLGGAWMTRLGSDLGNGRFDGTWLVSNFESLNPANTYWSKYYNLFRDVDTET- 
56 9gamm-c6n5e9    38.6%  AQALHEG--KPPILYGNCQAGWMLALLASDCVGSVG-LTVMNGSPVSYWANSE---EEANPMQLLGGLSGGVWSARFLSDLKDGTFDGAWLVSNFEMLNPTTAIWDKYYGLFDDIDGEH- 
57 legpn-Q8RNQ1    39.0%  VQAWHEG--KAPILYGNCQAGWMLALLASDCVGSVG-LTVMNGSPVSYWSNSE---EEANPMQLLGGLLGGSWSARFLSDLKEGILDGAWLVSNFELLNPTTAIWDKYYGLFDEIDAER- 
58 9rhob-a6e5f6    39.9%  VARRHPD--TAPVLYGNCQAGWAATLLAADCDGLTG-PIVLNGSPLSYWSGE----AASSPMRMMGALSGGAWAAHMISDLGDGRFDGAWLAQNFETLQPEKAIWDKYATLFAHADTER- 
59 9rhob-a9hui2    40.9%  VARRHPD--KAPVLYGNCQAGWAAALLAADCDGLTG-PIVLNGSPLSYWSGE----AASSPMRMLGALSGGSWAAHMIADLGDGRFDGAWLAQNFETLQPEKAIWEKYVNLFSHADTER- 
60 acide-c5t1r9    41.0%  VALRHPG--NPPVLYGNCQAGWAVTLLSADCAGLVG-PVVLNGSPLSYWAGE----SGVNPMRLSGGLLGGSWLAHLTADLGNGRFDGAWLAQNFENLKPEKAIWEKYAQLFTNVDSEQ- 
61 acisj-a1w603    41.0%  VAQRHPG--NPPVLYGNCQAGWALTLLSADCAGLVG-PVVLNGSPLSYWAGE----SGVNPMRLSGGLLGGSWLAHLTADLGNGRFDGAWLAQNFENLKPEKAIWEKYAQLFTNVDSEQ- 
62 aciet-b9mbf1    39.3%  VAQRHPG--KPPVLYGNCQAGWAVTLLSADCAGLVG-PVVLNGSPLSYWAGE----PGVNPMRLSGGLLGGSWLAHLTADLGNGRFDGAWLAQNFENLKPEKAIWEKYAQLFTNVDTEQ- 
63 acisj-a1w9c9    36.4%  VAQRHPG--KPPVLYGNCQAGWAVTLLSADCAGLVG-PVVLNGSPLSYWAGE----SGVNPMRLSGGLLGGSWLTHLTADLGNGRFDGAWLAQNFENLKPEKAIWEKYAQLFTNVDSEQ- 
64 burvg-a4jv42    39.3%  VARRHPG--KPPVLYGNCQAGWAITLLSADCEGLVG-PAVLNGSPLSYWAGE----PGVNPMRIAGGLVGGAWLTHLLADLGDGRFDGAWLAANFENLKPE-AVWEKYANLFAHVDTER- 
65 brasb-a5eul1    41.3%  VRARHPD--QPPILYGNCQAGWAVTLLSADCHGLVG-PAVLNGSPLSYWSGE----AGVNPMRLSAGFNGGAWLAHLMADFGDGRFDGAWLVQNFENLKPE-SVWDKYAGLFTDIDHER- 
66 metea-c5b1t3    38.3%  VAQRHPG--KAPVLYGNCQAGWAVTLLSADCRGLVG-PAVLNGSPLSYWAGE----AGVNPMRISAAFTGGAWIAHLLADLGGGRFDGAWLVQNFENLKPE-AVWEKYANLYVQVDSER- 
67 meted-c7cfx5    39.1%  VSLRHPG--KPPVLYGNCQAGWAVTLLSADCQGFVG-PAVLNGSPLSYWAGE----AGVNPMRIAAGFLGGAWIAHLLADLGDGRFDGAWLVQNFENLKPE-GVWEKYANLYVQVDSER- 
68 xanp2-a7ip61    37.6%  VSWRHSG--AAPVLYGNCQAGWAVTLLAADCAGLAG-PAVLNGTPLSYWAGE----TGINPMRIAAGFEGGAWLTHLLADLGDGRFDGAFLVQNFEGLKPE-AVWDKYANLYTHLDTER- 
69 xanp2-a7iq18    37.1%  VSRRHSG--AAPVLYGNCQAGWAVTLLAADCAGLTG-PVVLNGTPLSYWAGE----SGINPMRIAAGFEGGAWLTHLLADLGDGRFDGAFLVQNFEGLKPE-AVWEKYANLYAHMDTER- 
70 xanp2-a7ipv4    35.2%  VSRLHPG--QAPVLYGNCQAGWAVTLLAADCAGLTG-TTVLNGTPLSYWAGE----SGINPMRIAAGFEGGAWLTHLLADLGDGRFDGAFLVQNFEGLKPE-AVWEKYANLYAHVDTER- 
71 rhopt-b3qg39    39.9%  VAIRHAG--RAPILYGNCQAGWAVTLLSADCSGLVG-PAVLNGSPLSYWSGE----AGVNPMRLAAGFNGGVWLAHLVADLGDGRFDGAWLAQNFENLKPE-AQWEKYANLFTHIDRER- 
72 ralp1-c6br16    35.6%  VARRHDG--QAPVLYGNCQAGWEVMLLSAHCCERVACPAVLNGSPLSYWSGE----AGVNPMRLLGAFTGGVWSANFLADLGNGRFDGAWLVQNFEALKPESALWTKLYTVFADPDGEG- 
73 polna-a1vvx2    40.5%  IARRHG---VAPVVYGNCQGGWAAALLAAECEGLDG-PAVLNGSPLSYWAGA----EDVNPMRLAGGLLGGEWLTHLMADLGGGRLDGAWLVQNFEGLNPANTWWQKNYNLYAHVDTES- 
74 desah-c0qhm8    37.2%  INRLHPDA-EKPALIGNCQGGWAAALIGADRPDLTG-PLVFNGSPLSYWAGV----EGKNPMRYKGGLTGGTWMTSLFSDLGNGKFDGANLVAGFEDLNPANSLWTKQYNVYARIDTEE- 
75 lepcp-b1xwq8    36.8%  VAARHPQCTAKPLVIGNCQAGWAMAGLAAMRPELFG-PLILVGSPLSYWAGG----AQLNPMRYSGAMLGGAWLAALTSDLGADRFDGAHLVKNFENLNPANSLWGRYYKLWSQVDNES- 
76 azovd-c1djw3    20.5%  LGGR-------VNIVGLCQGGWTAAMLAARFPDKVN-SLVLAGAPIDTDA-------GDGPIRGMVHESPISFYEDLVA-LGGGLMKGEFMLQGWKNMRPGEHYILEHIDLYEHIDDPVY 
77 beii9-b2igq5    16.8%  VGGR-------VNLIGLCQGGWMSAMYAARFPHKVA-SLVLAGSPIDTDA-------GNGPIKQMAHTYPLSFYQELVQ-MGEGLMRGKFMLAGWKNMHPEAHYFQNYIDLYEHIDDPNY 
78 burcc-b1k8j3    18.1%  LGGR-------VNLVGLCQGGWMSAMYAARFPHKVA-SLVLAGSPIDTDA-------GDGPIKRMVHTYPTAFYDELVA-MGGGLMRGRFMLRGWKNMHPDQHYLAEHIDLYEHLDDPEY 
79 burvi-q4bi33    17.8%  LGGR-------VNLVGLCQGGWMSAMYAARFPHKVA-SLVLAGSPIDTDA-------GDGPIKQMAHTYPLSFYEELVA-MGGGLMRGRFMLRGWKNMHPDQHYLADHVDLYEHLDDPDY 
80 burvg-a4jv47    10.9%  LGGR-------VNLVGLCQGGWMSAMYAARFPDKVA-SLVLAGSPIDTDA-------GDGPVKRMAHTYPVSFYEELVT-LGGGLMRGKFMLDGWKNMHAEEHYITQHIDLYEHIDDPLY 
81 metsb-b8ern6    13.5%  LGGR-------VNLIGLCQGGWMAAMFAARYPYKVA-TLTVAGAPLDCDA-------GDGFVKKIAKEQPMAFFEELVN-AGGGRMRGKFMLAGWKSMHPEEHYFKTHVDLYENVEDPAF 
82 braja-BLL4548   12.1%  IGVP-------VDLVGLCQGGWLSLLYAARFPAKVR-RLVLVGAPVDLSI--------DSSLSRLARNAPEMVYDQLVA-RGGGNVSGEEMLR-FWSRTPSREDIAAALQVGLSDEEGG- 
83 synww-q0axu9    11.1%  VRKR-TGV-YKIHLVGQCQGGWQASIYTSLFPDKIS-TLVSAAAPIDVNA-------KPSPIVEYAQKLSIDVFRFMVN-SGGGVMPGKFILQGFKSMQPEEHYVRKYFRLWQMIKEGDE 
   consensus/100%         h............hhu.CQuGa...hh........t..hh.susPhs..............h...st..s..h...h.t..tts.h.G..hh..a...pst...h.t.htlh...c.... 
   consensus/90%          l.thH......PhlhGNCQuGWthhhhuu..st.hu.shllsGuPhshhu.......u.sPh+h.uuh.GGsa.s.hhuDlGtGhhDGshlltsF-.hpPt.thatK.hplatphDpt.. 
   consensus/80%          lhthHst....PhlhGNCQuGWthhhhuA.tsthhG.PlllsGuPluYWuG......G.sPMRh.uGhhGGsWhsthhuDLGsGhFDGAaLlpNFEthpPtpshatK.hplasplDsE.. 
   consensus/70%          VtthHPt...tPsllGNCQuGWthhhlAA.pPchsG.PlllsGuPlSYWuG......GpNPMRhsGGlhGGsWhstLhuDLGsGpFDGAaLVpNFEpLsPspshWpK.asLasplDsEt. 

 1 9burk-b1g6q9   100.0%  ---PRFLDFERWWGDYYLMNREEIEWITHNLFIGNKLWS-GDVRG-------SSG-KAFDLREIRSPIILFASLGDNITPPQQAFNWVADLYGSTEEIKARGQVIVGLMHQDIGHLGIFV 
 2 9burk-b5wax2    67.4%  ---PRFLEFERWWGSYYLMNREEIEWITRNLFVGNKLWS-GGVKD-------SSG-QTFDLREIRSPIILFASMGDNITPPQQAFNWVADLYGSTEEVKARGQVIVGLTHKSIGHLGIFV 
 3 9burk-b5wqb7    65.1%  ---ARFIEFERWWGSYYLMNREEIEWITRNLFIGNKLWS-GEVSG-------PSG-KSFDLRAIRSPIILFASMGDNITPPQQAFNWVADMYSSTEEIKVRGQVIVALMHEDVGHLGIFV 
 4 burs3-q391x0    67.5%  ---PRFLEFERWWGGYYLMNREEIEWITRNLFIGNKLWS-GEVRD-------GAG-NAFDLREIRSPIILFASMGDNITPPQQAFNWVADIYGSTEEIKSRGQVIIGLVEEDVGHLGIFV 
 5 cupnh-q0k0q7    64.5%  ---PRFLEFERWWGGYYLMNREEIEWITRNLFVGNKLWG-GEVKN-------AGG-KAFDLREIRSPIVLFASMGDNITPPQQAFNWVVDIYGSTEEIKARGQVIVGMMHRSVGHLGIFV 
 6 cuptr-b3r4w6    64.6%  ---PRFLEFERWWGGYYLMNREEIEWITRNLFVGNKLWG-GDVKG-------AGG-KAFDLREIRSPIVLFASLGDNITPPQQAFNWVADIYGSTEEIKARGQVIVGMMHESVGHLGIFV 
 7 cuppj-q472w1    63.6%  ---PRFLEFEHWWGGYYLMNREEIEWITRNLFVGNKLWS-GDVKD-------AGG-RAFDLRDIKAPIVLFASMGDNITPPQQAFNWVVDVYGSTEEIKARGQVIVGMMHENIGHLGIFV 
 8 azovd-c1dgm6    61.2%  ---PRFLEFERWWGGYFLMNREEIEWITRNLFVGNRLWS-GETGA-------GRGKPVFDLRDIKSPIVLFASLGDNITPPQQAFNWVADIYASTEEIKARGQIIVGLLHQDIGHLGIFV 
 9 metno-b8ihj3    46.9%  ---ERYLEFERWWGGYFLMNRDEIKWIVDNLFVGNRLAS-GGAEW-------SEG-RAFDLRAIRSPIILFASLGDNITPPQQAFNWVADLYPTTQDLKANGQVIVGLMHQSIGHLGIFV 
10 mets4-b0umc8    45.9%  ---ARYLEFERWWGGYFLMNREEIRWIVDNLFVGNRLAS-GSAEW-------AEG-RTFDLKAIRSPIILFASLGDNITPPQQAFNWVADLYPTTADLKANGQVIVGLMHESVGHLGIFV 
11 xanp2-a7ikd9    37.9%  ---ARFLEFERWWGGYFLMNREEIKWIVENLFVGNKLAA-GKAEW-------APG-KTFDLKAVRSPIIVFASLGDNITPPQQAINWVADLYPTTQALKNAGQVVVGLMHQSVGHLGIFV 
12 aroae-q5p962    32.4%  ---VRYLEFERWWGGHVVLGGQEIQYIVDNLFIGNRLST-AQLMT-------SDG-RRIDLRNVRSPVVVFCSRGDDITPPPQALGWVRDLYEGVDGIIANEQTIVYCVHDSTGHLGIFV 
13 chrsd-q1qx98    37.1%  ---ARYLQFERWWGGHIVLNAQEIQYIVDNLFIGNRLST-AQLIT-------RDG-RRIDLRNVRSPIVVFCSQGDNITPPPQALGWISDLYDGVEDIVANEQTIVYCVHDSTGHLGIFV 
14 borpd-a9hzm8    35.2%  ---ERYLSFEKWWGGHVFLNAPEIQYIVDNLFIGNRLAT-AGLVT-------SDG-IRIDLRNIRSPIIVFCSKGDNITPPPQALGWIPDLYQDDAEVVAHNQTIVYAVHESIGHLGIFV 
15 borpe-q7vzb4    34.5%  ---PRYLEFEKWWGGHVFLNGPEIQYIVDNLFVGNRLAT-AGLVT-------SDG-IRIDLRNIRSPIIVFCSKGDNITPPPQALGWITDLYQDDREVVAHNQTIVYAVHESIGHLGIFV 
16 burp8-b2jmm5    35.0%  ---PRYLSFEKYWGGHVFLNAAEMQYIVDNLFVGNRFVS-GEIVT-------SDG-VRLDLRNIRSPIVVFCSYGDNITPPPQALGWITDLYRDDADLLGHDQTIVYATHDSIGHLGIFV 
17 ralso-b5s536    35.4%  ---PRYLGFEKYWGGHVFLNAAEMQYIVDNLFVGNRFVR-GEIVT-------SDG-VRLDLRNIRSPIVVFCSHGDNITPPPQALGWITDLYRDDADLFGHDQTIVYATHDRIGHLGIFV 
18 burvg-a4js32    35.6%  ---GRFLDFEEYWGGHVFLNDVEMQYIVDNLFVGNRLAT-AELIT-------SDG-IRLDLRNIRSPIVVFCSYGDNITPPPQALGWITDLYRDDMDVLTHDQTIVYATHESIGHLGIFV 
19 comte-b7wqc8    31.9%  ---PRHLQFEKYWGGHVFLNDVEIQYIVDNLFIGNKLST-AQLMT-------SDG-VRIDLRNIRSPILVFCSYGDNITPPPQALGWITDLYRNDLDVLGHDQTIVYATHDSIGHLGIFV 
20 parl1-a7hyr7    36.3%  ---PRYLQFEKYWGGHVFLNDVEIQYIVDNLFIGNKLST-AQLVT-------SDG-VRIDLRNIRSPIVVFCSYGDNITPPPQALGWITDLYRNDLDVMGHDQTIVYATHDSIGHLGIFV 
21 delas-a9brz2    33.6%  ---PRYLGFEKYWGGYVFLEGREMQYIVDNLFIGNRLAT-AELTT-------SDG-VRIDLRNIRSPIVVFCSHGDNITPPGQALGWITDLYRDDEDIAAHDQTIVFATHDSIGHLGIFV 
22 nitec-q0ajy0    34.3%  ---QRYLGFEKYWGGYVFLNDVEMQYIVDNLFIGNRLAT-AELIT-------SDG-ERIDLRNIRSPIVVFCSYGDNITPPPQALGWITDLYGDDEDVLTHDQTIVYATHDSVGHLGIFV 
23 comt2-d0j233    35.2%  ---ERYIDFEKYWGGYVFLNDVEMQYIVDNLFIGNRLST-AQLLT-------SDG-VRIDLRNIRSPILVFCSYGDNITPPAQALGWITDLYASDDDVRGHDQTIIFSTHDSIGHLGIFV 
24 comte-b7x1q8    33.0%  ---ERYIGFEKYWGGYVFLNDVEMQYIVDNLFIGNKLST-ARLLT-------SDG-VRIDLRNIRSPILVFCSYGDNITPPAQALGWITDLYASDDDVRAHDQTIIFSTHDSIGHLGIFV 
25 beii9-b2iia7    35.6%  ---ERYLDFERWWGGHVNLNAQEIQFIVDELFIGNNLAA-GRIQT-------SDG-TAIDLRNIRTPIVVFCSKGDNITPPQQALGWILDLYQNVDEIRSYGQTIVYTIHETIGHLGIFV 
26 braja-BLR3456   35.2%  ---NRYLEFERWWGGHVNLNAEEIQFIVDELFIGNNLAA-GKIEM-------SDG-RRVDLRNIQSPIVVFCSEGDNVTPPQQALDWILDCYADVDEIRAYGQTIVYTVHKSIGHLGIFV 
27 nithx-q1qpw8    35.6%  ---ERYLEFERWWGGHVNLNAEEIQFIVDELFVGNNLAA-GRIRM-------SDG-QPVDLRNIRSPIVVFCSKGDNITPPQQALDWILDLYADVDEIRAYAQTIVYTVHENVGHLGIFV 
28 rhime-yack      35.5%  ---GRYLGFERWWGGHVRLNAEEMQFIVDELFVGNKLAA-GKIQT-------SDG-TTIDMRNIRSPIVVFCSKGDNITPPAQALDWILDLHDSVDEIRAHGQTIVYTVHEKIGHLGIFV 
29 rhisn-c3krv5    36.8%  ---GRYLGFERWWGGHVTLNAEEMQFIVDELFVGNKLAA-GEIRT-------SDG-TAIDLRNIHSPIVVFCSKGDNITPPPQALDWILDLYDSVDEIRAHGQTIVYAVHDKIGHLGIFV 
30 brasb-a5eg29    36.4%  ---SRYLDFERWWGRHVNLNAEEMQFIVDELFVGNRLAA-GHIRT-------SEG-NAVDLRNIRSPIVVFCSKGDNITPPQQALGWILDLYSDVDEIRSYGQTIVYTVHETVGHLGIFV 
31 azos1-d3p281    36.0%  ---ERFLDFETWWGSPVLLNAVEMQFIADELFLRNKLSS-GEIVF-------SDG-MRVDLRNIRTPIVVFCSWGDDITPPQQALGWILDLYDTDRELIAGGQTIVYALHQSIGHLGIFV 
32 beii9-b2icg9    36.5%  ---PRFLDFESWWGNPITLNAQEMQFIADELFVGNKLTC-GEIVT-------SDN-VRVDLRNIKSPIIVFCSWGDDITPPQQALGWITDLYDSRDEIVANGQTIVYTLHDSIGHLGIFV 
33 metsb-b8ert2    37.3%  ---GRFLDFETWWGNPVLLNAGEMQWIADNLFVGNRLTS-GEIRT-------SGG-VKVDLRNIRAPIVVFCSWGDDITPPQQALGWITDLYATDAELAEGGQTIVYALHESIGHLGIFV 
34 azosb-a1k5s0    35.9%  ---ERFLEFERWWGGHFLLNKAEMEWITQNLFVGNRLSA-GDIVS-------SDGRIRIDLRNIRSPIIVFASWGDNITPPQQALNWIHDLYEDVEDIRLNEQTIVYCLHEKIGHLGIFV 
35 chrvo-q7nwh6    35.3%  ---QRYLDFERWWGGHYLLNKAEMEWIAQKLFVGNELVH-GKITS-------HDGKVRVDMRNIRSPIMVFASWGDNITPPQQALNWIADLYDNVEDIRNNEQTIVYCLHNKVGHLGIFV 
36 chrvo-q7p1c7    36.6%  ---NRFLEFERWWGGHYLLNKEEMEWISQNLFVGNRLSR-GEVYL-------DDGAVRIDLRQIRSPIIVFASWGDNITPPQQALFWIADLYKDVEEIRGNEQTIVYCLHEQIGHLGIFV 
37 cupnh-q0kdv2    38.9%  ---PRFLDFERWWGGHFLMNRAEIDWIVQKLFVGNRLTA-GEVRS-------TDGKTVVDLRNVRSPVIIFASWGDNITPPQQALNWIPDLYASDEELVANDQVIVYCLHPTVGHLGIFV 
38 cuppj-q475c4    38.4%  ---PRFLEFERWWGGHFLMNRAEIDWIVQNLFVGNRLTA-GQVRS-------ADGKTVVDLRNIRSPIVVFASWGDNITPPQQALNWIPDLYATDEELVANDQVIVYCLHPTVGHLGIFV 
39 ralme-q1lqx6    41.4%  ---PRFLEFERWWGGHFLMNRGEIDWIVQNLFVGNHLTA-GEVRS-------NDGKTVIDLRNVRSPVIVFASWGDNITPPQQALNWIPDLYANVDEIVANDQTIVYCLHPSIGHLGIFV 
40 acicj-a5ft95    35.2%  ---ARYLAFEKWWGDFIQLNGDELQFLVDNLFIGDKLTR-GQLAS-------SDG-RIFDLRNIRSPIIAFASTADNISPPPQSLGWILDLYRNVDEIRAADQTIVYCLDHKIGHLAIFV 
41 azoc5-a8ih86    33.7%  ---QRYLGFEKWWGDFITLNGDEIQFLVDELFIGDGLTR-NEMRS-------SDG-TVFDLRNIASPLIVFTSLGDNISPPPQTLGWILDLYKDVDAIHAEGRTIVYCLNQTVGHLAIFV 
42 azosb-a1k696    41.1%  ---RRFLDFEKWWGGFVQLTADEMRGIVDDLFVGNKLAT-GGIPL-------GRG-QTLDLRRVRSPVVVFCSQGDNITPPQQALNWIADTYSCTREIKAHGQTIVYIIHADAGHLGIFV 
43 9rhob-a0p290    35.6%  ---KRFLEFERWWGGYFLLNEAEMKWIVEQLFVGNRLSK-NEAQL-------ETG-RNVDIKHIRAPIIVFASYGDNITPPQQALNWIIDTYTDEREIAIRGQRIIYMIHEQVGHLGIFV 
44 9rhob-b9r693    36.5%  ---HRFLEFERWWGGYFLLNEAEMKWIVEQLFVGNKLSK-NEAQL-------EPG-RNIDIKQIRAPIIAFASFGDNITPPQQALNWIIDTYTDEREIAIRGQRIIYMVHDQVGHLGIFV 
45 meted-c7cnd9    37.5%  ---ERFLEFEKWWGGMFLMNEPEICWIVEQLFVGNKLVK-NTAQL-------EPG-RPIDLKGIRAPIIVFSSFGDNITPPQQALNWLVDTYADVDEMRIHGQRIIYMLNDEIGHLGIFV 
46 brasb-a5ef53    38.5%  ---ASFLEFERWWGGFHFMNEQEIRWIVEQLFIGNRLSR-GEARI-------ERG-RQLDLKAIRSPIIVFASWGDNITPPQQALNWIVDTYADEHEIRIRGQRIIYMVHDKVGHLGIFV 
47 braso-a4z1h1    38.2%  ---ASFLEFERWWGGFHFMNEQEIRWIVEQLFIGNRLSR-GEARI-------ERG-RQLDLKAIRSPIIVFASWGDNITPPQQALNWIVDTYADEHEIRIRGQRIIYMVHDKVGHLGIFV 
48 rhop5-q07lt7    39.2%  ---ERFLEFERWWGGFHFMNEAEIRWIVEQLFVGNKLAR-GEARL-------EHG-RHLDLKQIRSPIIVFASHGDNITPPQQALNWIIDTYADENEIKIRGQRIIYMVHEKVGHLGIFV 
49 metsb-b8eqs6    37.0%  ---DSFLEFERWWGGYHFMTEAEIRWIVEQLFVGNRLAR-NEARI-------EHG-RQIDLKQIRSPIIVFTSYGDAITPPQQALNWIPDTYADENEIKIRGQRIIYMIHEKVGHLGIFV 
50 rhiet-YP061     33.9%  ---EAFLKAEKWWGGFCLMRGDEIRWIVEHLFVGNRLAH-NKAYG------EPDR-RHFDLKKIRAPIIIFASHGDNVTPPQQALNWIPEIYDNEEEIRLLGQHIIYMVHNDVGHLGTFV 
51 9rhob-b6yy40    36.0%  ---ERYLEFQKWWNGFYYMTEEEFRWILDNLFIGNKLAK-NEAFL-------EPG-RPIDLKTIKSPIIVFSSYGDNITPPDQALNWIADTYTDDAEIEILGQRILYMLHDQVGHLGIFV 
52 metsb-b8eis0    42.4%  ---PRFKAFEKWWSSFYDLNEAEIRWIVENLFIGDKLER-GDAML-------GGR-GAVDLRKIKSPIIIFASKGDDITPPPQALAWIAKVYGDEREIRARGQKILYIVHEDIGHLGIFV 
53 legpa-q5x3d6    39.5%  ---IRFLNFERWWGGFSLLNVNEMRGIIDNLFIGNKLVH-GKIPL------GQSG-NNLDLRNISVPVIIFCSEGDNITPPQQALNWVSDLYSNTLEIKLDGQVIVYLIHKSVGHLGIFV 
54 azovd-c1dif2    30.8%  ---QRFLDFERWWGSPNLFNSEEIETIVDELFIGNRLTG-GQN-------------TLTDLRKIEAPVVVFCSYGDNITPPQQALNWIADLYPSDLALHSSGRTIIYLKHASAGHLGIFV 
55 pseu5-a4vhe6    34.3%  ---SRFLDFERWWGSPTLLNSEEIEVIVDDLFIGNRLTG-GS----------GGR-SSIDLKRIEAPVVVFCSYGDNITPPQQALNWIADVYPSDLALRSAGRTIVYLQHASIGHLGIFV 
56 9gamm-c6n5e9    38.6%  ---DRFLEFERWWSGFYQFSQEEIIATVNNLFIGDQFER-GEMVI-------HKG-CIYDLKRIHNPIVIFASQGDQITPPRQALHWIRTIYPDTQALKKAKQRIVYLLHPSIGHLGIFV 
57 legpn-Q8RNQ1    39.0%  ---ERFLEFERWWNGFYQFSQEEIMATVNNLFIGNQLER-GEMRI-------HKG-CVYDLKRIQSPIVLFASQGDQITPPRQALHWIRTIYPTTQALKEAKQRVVYLLHPSVGHLGIFV 
58 9rhob-a6e5f6    39.9%  ---ERFVEFERWWNGYYTLSREEILGITQNLFIGNRLEQ-GEMQL-------DAH-CTVDLKRISNPLIIFASDGDNITPPEQAMGWIGKLYPDTDALKAAGQRIVYMTHPRVGHLGIFV 
59 9rhob-a9hui2    40.9%  ---ERFLDFERWWNGYYTLSREEILGITQNLFIGNRLEQ-GEMQL-------DAH-CTIDLKRIRNPIIVFASEGDNITPPQQALGWIAKLYPDTEALKAAGQRIVYMTHETVGHLGIFV 
60 acide-c5t1r9    41.0%  ---ARFLEFERWWNGFYFLSREEILAIVENLFIGNQLEQ-GVFQI-------CLG-CTADLRRIKNPIVIFASYGDNITPPHQALGWIPAVYSDTEDLKRAGQRIVYLTNRHVGHLGIFV 
61 acisj-a1w603    41.0%  ---ARFLEFERWWNGFYFLSREEILAIVENLFIGNQLEQ-GVFQI-------CQG-CTADLRRIKNPIVIFASYGDNITPPHQALGWIPAVYSDTDDLKRAGQRIVYLTNPHVGHLGIFV 
62 aciet-b9mbf1    39.3%  ---GRFLDFERWWNGFYFLSREEVLAIVENLFIGNQLEQ-GLFKI-------CQG-CTADLRRIRNPIVIFASYGDNITPPHQALGWIPAVYQDTDDLQQAGQRIVYLTNPHVGHLGIFV 
63 acisj-a1w9c9    36.4%  ---RRFLDFERWWNGFYFLSREEMLAIVENLFIGNQLEQ-GLFQI-------CQG-CTANLRRIRNPLVIFASYGDNITPPHQALGWIPAVYQDTDDLRRAGQRIVYLTNPHVGHLGIFV 
64 burvg-a4jv42    39.3%  ---ERFLEFERWWNGFYFLSRNEILAIVENLFIGDRLEQ-GSFRI-------CDG-CTADLKRIRNPLVIFASYGDNITPPQQALGWIPAVYKDDAELRAAGQRIVYLTNPHVGHLGIFV 
65 brasb-a5eul1    41.3%  ---ERFLSFERWWNGYYFLSREEILSIVENLFVGNQLEQ-GLFRI-------CGG-CVADLRRIRNPIVIFASYGDNITPPHQALGWIPAVYKSTEDLQAAKQRIVYLTNPHVGHLGIFV 
66 metea-c5b1t3    38.3%  ---ERFLSFERWWNGFYFLGREEILAIVENLFIGNQLEQ-GLFRI-------CAG-CHADLRRIRNPLVIFASYGDNITPPHQALGWIPVVYRDTADLKAAGQRIVYLTNPHVGHLGIFV 
67 meted-c7cfx5    39.1%  ---ERFLSFERWWNGFYFLGREEILSIVENLFIGNQLEQ-GHFRI-------CAG-CNADLRRIRNPLVIFASYGDNITPPHQALGWIPVVYRDTAELKAAGQRIVYLTNPHVGHLGIFV 
68 xanp2-a7ip61    37.6%  ---ERFLAFERWWGGYYFLSREEILAIVENFFVGNRLEQ-GRVQI-------CEG-CHADLRRIRNPLVIFASYGDNITPPHQALGWIPAVYKDTDDLKAAGQRIVYLINRHVGHLGIFV 
69 xanp2-a7iq18    37.1%  ---ERFLAFERWWGGYYFLSREEILAIVENLFVGNRLEE-GRLRI-------CAG-CHADLRRIRNPLVIFASYGDDITPPHQALGWIPVVYRDTDDLKAAGQRIVYLVNRHVGHLGIFV 
70 xanp2-a7ipv4    35.2%  ---ERFLAFERWWGGYYFLSREEILAIVENFFVGNRLEQ-GRVRI-------CHG-CHVDLRRIRNPMVIFASYGDDITPPHQALGWIPTVYRDTDDLKAAGQRIVYLVNRHVGHLGIFV 
71 rhopt-b3qg39    39.9%  ---ERFLDFERWWGSFFFLSREEILAIVENLFIGNQLED-GRFRI-------CEH-CFADLRRIRNPLVIFASYGDNITPPHQALGWIPIVYRTTSELIQAGQRIAYLTNPHVGHLGIFV 
72 ralp1-c6br16    35.6%  ---DRFLEFERWWNGFYFLSREELVATIQDLFVGNKLET-GEVHV-------DGK-CTVDLRRICKPIVIFASYGDNITPPHQALGWIPVVYESTEALVAAGQRIVYLTNPHVGHLGIFV 
73 polna-a1vvx2    40.5%  ---ERFLEFERWWSSYFFLSREEILATVENLFIGNRLEQ-GQVQLDPCSIASQPD-CVVDLKRIRNPLVIFASSGDNITPPHQALAWLPAIYPTTEALKAAGQRIVYLLNPHVGHLGIFV 
74 desah-c0qhm8    37.2%  ---HRYLEFERWWNGYYYMTAEEIHFIVSNLFVGNRLEQ-GLLEL-------DER-TRIDLKNIEDPVLVFASSGDNITPPQQALNWIIKVWGSVDGLKTHGQVVVYLLHKTIGHLGIFV 
75 lepcp-b1xwq8    36.8%  ---QRFLEFERWWGGYFRMSGAEIEAIVENLFVGNKLAR-GDVQI--------GG-KRIDLRNITSPVVVFASWGDNITPPPQALNWIIDVWGDERAIAAAGRVIVYVLHESVGHLGIFV 
76 azovd-c1djw3    20.5%  --LRKKETFESWYENPIDLPGRWYLQVIGQLFKENRLAR-GEFAG--------LG-RRLDLRDITCPLYLLAGEGDDITSPEQVFN--------AANLVGTPQERIVRQLVPGGHIGLFM 
77 beii9-b2igq5    16.8%  --ISKEETFASWYEHPIDLPGRWYLQAITQLFKENRFAK-GTFVA--------LG-ETLNLKNVTCPVYLLAGETDDITTKEQVFD--------ADKYLGTPKDQIQKQLVPGGHIGLFM 
78 burcc-b1k8j3    18.1%  --LRKREVFANWYESPIDLPGRWYLQAIVQIFKENRLAK-GTFVA--------LG-RTLDLKDVACPVYLLAGEADDITTPEQVFG--------ARDLLGTPASRIESRLVPGGHIGMFM 
79 burvi-q4bi33    17.8%  --LRKREIFASWYESPIDLPGRWYLQAIQQIFKENRLAR-GTFVA--------LG-RTLDLKDVRCPAFLLAGETDDITTREQVFG--------AQQYLGTPAEQVTSRLVPGGHIGLFM 
80 burvg-a4jv47    10.9%  --LKKEETFERWYENPIDLPGRWYLQAIEQLFKENRLAK-GTFIG--------LG-RRLNLRDITCPVYLLAGEDDDITTREQVFD--------AEKYLGTPKGCIEKKLVPGGHIGLFM 
81 metsb-b8ern6    13.5%  --VKKREEFERWYENPLDLPGRWYLQAIRLLFKDNAFFK-GDFVA--------LG-RKIALKDIICPTFLLAGEGDDITPSPQVFS--------AEEKLGTPKDKIVKKLVPGGHIGLFM 
82 braja-BLL4548   12.1%  ---ALLARFDQWNVETLDLPGTYYLEIVNRIFRENQIAG-GNFVA--------LG-RAIDLKDVKAPIFLLAGLDDEVVPVTQALA--------TAGLVGTPPAFIAAASEPSNHLGLFM 
83 synww-q0axu9    11.1%  DGVKRFIHFENWYQYTQNLPGRFYLEIVKNIFKENNLTKPGSFQL--------DG-RPVDLRNISCPVIIMAGKKDHITPPEQAFA--------LKNYISTPAADVIEILTEGGHIGTLM 
   consensus/100%         ........htpa......h....h..h...hFhtsth.t.s.................hsh+tl..Phhhhsu.tDtlss..Qsh...........th.......h.......sHluhhh 
   consensus/90%          ....+altFEpaWss.h.hst.Eh..hhppLFlsNpL.t.uth...........t...hDL+plpsPlllFsS.GDsITPP.QAhsWl..ha.s.ttlh.tsphllhhhp.phGHLGlFV 
   consensus/80%          ....RaLpFE+WWsuah.hsttEh.hIlppLFlGNpLtp.uph.h.......ttG.hthDL+pI+sPlllFsShGDsITPPtQAhsWl.shY.sstplhttsQtIlhhhp.plGHLGIFV 
   consensus/70%          ...tRaLpFE+WWuGahhhstpEh.hIlcpLFlGN+Ltp.Gphhh.......stG.pthDLRpI+sPlllFsShGDNITPPpQALsWI.clYtssp-lhstsQpIVYhhctplGHLGIFV 

 1 9burk-b1g6q9   100.0%  SGKVAKKEHTQIVSVLEAIESFAPGLYGMSITERKDAN-------------GETEYEVEFREHRLEEIAAHFNRFEREDEKPFEAVAQLSEFNQRAYELFAQPIVQAMSNETTARLLREF 
 2 9burk-b5wax2    67.4%  SGKVAKKEHTQIVSVLETIETFPPGLYSMTINEVRNAA-------------GELVYDVEFHERRLEEISAHLNRFGRIDEKPFEAVAEWSTLNQRMYELLAQPFVQAMSNETNARMLRQF 
 3 9burk-b5wqb7    65.1%  SGKVAKKEYTQIFNVLETIETLAPGLYGMSIKEAKGAD-------------GKTEYEVSLTEHRLEEAVEHFNELRREDEKPFEAVAAMSEFNQRAYELFVQPVVQHASNETTARLLRDF 
 4 burs3-q391x0    67.5%  SGKVAKKEHAQIVSVLDAVETLPPGLYAMSIEEVKGAD-------------GKVAYEVTFAEHRLEEIAQHFNRFGRKDEHAFEAVAELSEFTQRAYELFMQPFVQQASNETTARLLRDF 
 5 cupnh-q0k0q7    64.5%  SGKVAQKEHAQIVSVLKSIELLPPGLYGMVIHERKGSD--------------GVDYEVQFEEHSLEEIASRLNRFERADEKPFETVANLSDFTQRAYELFAQPYVQAVSNEMTARVLREF 
 6 cuptr-b3r4w6    64.6%  SGKVAQKEHAQIVSVLKSIELLPPGLYAMRIQERKGSE--------------GVEYEVEFEEHSLEEIASRLNRFERVDEKPFEAVANLSDFTQRAYELFAQPYVQAVSNEMTARVQREF 
 7 cuppj-q472w1    63.6%  SGKVAQKEHAQIVSVLKSIELLPPGLYGMVIHEHKSAA--------------GVEYEVEFHEHSLEEIAQRLNRFERADETPFEAVAAMSDFTQRAYELFAQPFVQAMSNEASARMLREF 
 8 azovd-c1dgm6    61.2%  SGRVARKEHAQIVSVLKSIEMLPPGLYGMAIHERPGAG-------------GKLEYEVEFHEHRLEDVSARLNRLQRVDEKPFEAVAALSEFNQRGYELFLRPLVRLMASERSAELMRQL 
 9 metno-b8ihj3    46.9%  SASVARREHAQIVDLLEYIEHLPPGLYGMKVEEERADG--------------AVRYDVALREFQVEDLQK-LQKYARKDEVPFAAVEQVSAFNATLYETFVHPVMAAWARPETGRLARAF 
10 mets4-b0umc8    45.9%  SAGVARREHAQIVDLLDYIEHLPPGLYGMKVEEERADG--------------GVRYDAVLRELQVEDLQT-LQKYARKDEVPFAAVSRVSELNAAAYETFVHPVLSAWVPREIGALSRAL 
11 xanp2-a7ikd9    37.9%  SGAVARREHAQIVDLIEHVEGLAPGLYGMTIEEGHSGA--------------EVKYDVTLTELRVEDLAV-LQKYSRKDEIPFEVVANVSQVNARAYETFVHPVLSAVVTPEMGRALRAV 
12 aroae-q5p962    32.4%  SGSVSRKEHTEFTANMDYIDVLPPGLYETSISRADERA---------DAGLIEREYLLEFTPRTVAELDR-EIGHQPDDEARFATVARISEINLGLYRLFLQPWVRALATPSSAKWMRRM 
13 chrsd-q1qx98    37.1%  SGSISRREHAEFTANMDYIDVLPPGLYETAITARD------------GAETTDGDYLLEFRPRGVDDLQP-LVQPREDDERRFATVARLSESGLALYQHYAQPWMQLLMTPEAGRWIRRL 
14 borpd-a9hzm8    35.2%  SGSVARKEHHEFTANIDLIDVLPAGIYQAEIADKTPDTP--------NADLTEGDYVLSFARRKVDDVRA-IVARREDDDRRFAAVARISDINLGLYRSFVQPWVRAAVTPQSAEWLQRM 
15 borpe-q7vzb4    34.5%  SGAVARKEHQEFTANIDVIDVLPPGIYQAEIADKTPDTP--------NADLAYGDYVLSFERRRLDDVRE-IVERNEEDDQRFAAVARISDINLGLYRSFVQPWVRAAVTPQSAEWMQRM 
16 burp8-b2jmm5    35.0%  SSSTGKKEHREFVSNIDLIDLLPSGLYEADMGAKTEATP--------HADLVEGQYVLSISPRTIADVRE-IVQPNPESDRRFATAAYVSRFNLGMYRSFLQPWVRACTTPWTADMSSKL 
17 ralso-b5s536    35.4%  SSSTGRKEHREFVSNIDLIDLLPSGLYEAHMGAKTEATP--------HAELVEGENVLSISPRTLDDVRA-IVQPNPESDRRFATAAYLSRFNLGLYRSFMQPWVRTCVTPWAADLASKL 
18 burvg-a4js32    35.6%  SGGVGRKEHRKFAANIDLIDLLPSGIYEATIGANPEQNV--------QPAPVEGEFLLDVKPRKLDDIRE-IVQPDPQSDRRFDTAARCSDINLGLYRTFVQPWVRACVTPESARRLETL 
19 comte-b7wqc8    31.9%  SGSVGRKEHQEFAENIDIIDVLPAGIHHMQIDEHHDEAQ--------EHEPASDAYLTRIRRSNIDEIRE-IVRPDPESDRRFAAAARISEINLACYRSFVQPCVRAWVTTEGARSLEPL 
20 parl1-a7hyr7    36.3%  SGSVGRKEHQEFAANIDVIDVLPAGIHRMLVDENPDGSQ--------EGEPTGNAYLTRIQRSNIDEVRE-IVRPDPENDRRFAAVARISEVNLACYRSFVQPWMRALVTDQGAKWLEPL 
21 delas-a9brz2    33.6%  SGAVGRKEHREFAAHIDIIDLLPAGIYRAEIADRPAGVP--------AQDLTDDAYLMKIRRSDLAEVRS-IVRPDPESERHFAAAARVSEINLALYRNTVQPWVQALSTPLSARWLQAM 
22 nitec-q0ajy0    34.3%  SGAVSRKEHHKFTTNIDLIDVLPAGTYRATIAGDAPK----------NSGPSIGNYELSIEPTRMVDLRD-IVQPDPESDRRFAAVAQLSKTNLALYRQFVQPWVRQAVTPQTAHWVQTM 
23 comt2-d0j233    35.2%  SGAVGSKQHRKFASAIEQINLLPAGIYRASVDDATKQ----------EQKLLHDPYLLSIRASGIDEVRD-IVKPDPESDRRFDAAARISDINLALYRSIWQPWVRALSTSQSAHWLQTL 
24 comte-b7x1q8    33.0%  SGAVGSKQHRKFASAIEQINLLPAGIYRASVDDATAQ----------EQKLLHDPYLLSIRASGLDEVRD-IVKPDAQAERRFDAAARVSDINLALYRSLWQPWVRAFSTSESARWLQAL 
25 beii9-b2iia7    35.6%  SGGVAKKEHGEFSSNIDLIDVLPPGLYEAVFQAKTEQDA--------NLDLVSGEWLMRCETRTLDDIRA-LGGNNAADERRFEAAARVSDVNLALYRTFAQPIIRTFVNSSMSEWMKKE 
26 braja-BLR3456   35.2%  SGGVAKKEHAEFSSNIDLIDVLPPGLYEATFEAKGEETT--------SSDLVVGQWVMRCEARTLGDIRA-MGGNSPEDERRFAAAKRVSELNLAAYQKFVQPWIKTLVTPQMAETMRNL 
27 nithx-q1qpw8    35.6%  SGGIAKKEHAEFSSNIDLIDILPPGLYEATFEAKGTDTT--------NVDVAVGQWVMRCEARTLDDIRA-MGGNSPEDERRFAAAKRVSEINLAAYQKFLQPWIKGMVTPQVAELMRGL 
28 rhime-yack      35.5%  SAGVARKEHDEFASNIDLIDVLPPGLYEAVLEPVGPAVE--------NPDLVSGEWIMRCEARTLDDIRA-FGGNDLEDDRRFAAAARVSEINLALYRTYLQPWIKGMVTPPMAEAMRSM 
29 rhisn-c3krv5    36.8%  SAGVARKEHDEFASNIDLIDVLPPGLYEAVLEPAREVVE--------GRDLVAGEWVMRCEARTLDDIRA-LGGNDIDDERRFATAAKLSEVNLALYRTYLQPAVKAAVTPPIAEAMRRM 
30 brasb-a5eg29    36.4%  SSGVAKKEYREFAGNIDLIDLLPPGLYEATFEHADDAA---------DAALVCGDWVMHCRERTLDDIRA-MGGNTSDDERRFATVARVSEINLSLYRTFVQPAIRASMTPQAAEWLRQV 
31 azos1-d3p281    36.0%  SAKVANKEHDEFARTMDLIDVLPPGLYEAVFTEKTTDMP--------HPELVSGDHLVRFERRRLDDIRA-LGGNDAADDRRFATLARLSALNKGLYRATLGPVVNALATPQSAGALRAM 
32 beii9-b2icg9    36.5%  SGKIATREHGEFTQAMDLIDLIPPGLYEAVIADVGQETA--------NPELIEGRYLLVLQPRNLDDIRA-LGGNDLADERRFASLARLSDVNQGLYRTFASPVVRSLVTKESADYLRRL 
33 metsb-b8ert2    37.3%  SGKVATKEHDKFVNCLDAIELLPPGLFQAVITEVDGTVA--------NRDLVEGRYLLRFEPRTLSDIRA-LGGNDAEDDRRFETVARVSEVNKALYRKFLSPAVRALSNEKTAEFLRKS 
34 azosb-a1k5s0    35.9%  SASVAQKQTNKLVGALELIDILPPGLYEAVIEDTHPEMP--------GREYVQGRFHVRFEPRSIDDILA-L-DDGREDERAFEVVKRVALVNQGLYDTFVSPWVRLFSSELMAETFRNL 
35 chrvo-q7nwh6    35.3%  SAGVANKEHSEFASALDLVDVLAPGLYEAIIEDIAPDAP--------GQEYIEGRYIIRFEARDVSDILA-L-DDGRDDERAFEVVKRVSEINQGVYDRYVSPALRAAGTEAGARLLREL 
36 chrvo-q7p1c7    36.6%  SAGVANKEHSELASALDLIDVLPPGLYEAVITDTYPEMP--------GLQYLQGRYVIRFEPREVDDILA-L-GDGRDGERAFQVVKRVAEINQQLYDSFVSPWLQACTTPWTAHLMREM 
37 cupnh-q0kdv2    38.9%  SAGVANREHSELFCALDLIDVLPPGLYEAKIEDVAPDLR--------HRDLVEGRYLMRFERRGIADILA-L-DDGRDDERAFEVVRRVAEVNQHIYDTFASPWVRAMSNELSAQWLRAL 
38 cuppj-q475c4    38.4%  SAGVANREHSELFCALDLIDVLPPGLYEAKIEDIAPGTP--------HRDLIEGRYMVRFERRKIADILA-L-DDGREDERPFEVVRRISEVNQHLYDTFASPVVRASTTELTAEAARAV 
39 ralme-q1lqx6    41.4%  SGSVANKEHSELFCALDLIDVLPPGLYEAKIDDIAPGTS--------HKDLIEGRYMVRFERRTIDDILA-L-DDGRDDELPFQVVRRVAEINQHLYDTFASPFLRAMSNESMAEVIRAV 
40 acicj-a5ft95    35.2%  STKVGAEQDEEFVQMIDVIDCLPPGLHEMIISPRPAETP--------RGGFVTGDWIARFETRSLDDIRA-LGRNSPEDDRAFAAVARLSALNLAAYRRILQPLVRALANQPMADLTRAL 
41 azoc5-a8ih86    33.7%  SAKVGAKEDEEMVRLMDLIDCLPPGLYELVISPASEEEV----------KAGGHPWHSRFEARSLEDIRA-FGRNSVEDDRAFAAVRRVSEINLSLYRTFLQPAVRALANPHMAELLFAT 
42 azosb-a1k696    41.1%  SGSVVRREFSQIAGTLANIEALPPGLYELTITDTHIDEH------------GVQQYDVSLHEREIEDILA--HDDSREDERAFHIVAAVSELNGRVYDLFVSPWVRQGASALSAWWMKEL 
43 9rhob-a0p290    35.6%  SSKIAKKEHTEVTSTLKTIEALAPGLYEMTIDDYEGPL-------------LEREFTVSFHERKMEDLAK-I-DDGRDDEIPFAAVARASEQQAEFYDVCVRPFVQAFVTEQSADLRRKS 
44 9rhob-b9r693    36.5%  SSKIAKKEHTEVTSTLKTIEALAPGLYEMTIDDYEGGL-------------LDREFSVSFHERKMQDLMK-I-DDGRDDEIPFAAVARASEQQAEFYDVAVRPFVQAGVTEQSAELRRKT 
45 meted-c7cnd9    37.5%  SAKIAKKEHTEVSSVMRTIESLPPGLYEMKIEAAQGDG-------------IDRQFTVAFYERTLDDVRR-I-DDGRVDERPFAAVDRFSTAQAEAYDVLVRPLVKAMVTAPMAEASRAL 
46 brasb-a5ef53    38.5%  SSSIAKKEHTEVASTMKTIEALAPGLYEMTIDEQIGEG-------------IAARFHVSFHERKISDILA-IDDNDRSEERGFAAVARLSELGAELYDLTARPLVQSMVTDEMAKLISDA 
47 braso-a4z1h1    38.2%  SSSIAKKEHTEVASTMKTIEALAPGLYEMTIDEQIGDG-------------VDARFHVSFHERKISDILA-IDDNDRSEERGFAAVARLSELGAELYDLTARPLVQSMVTDEVAKLMRDA 
48 rhop5-q07lt7    39.2%  SSSIANKEHSEVASTMKTIEALAPGLYEMAITDQQGEG-------------VHARFTVSFTERKLDDIRA-LDDGQREEEHAFAAVDRLSQLGAEAYDLGLRPLVQAAITPQIAETLRNA 
49 metsb-b8eqs6    37.0%  SSSVAKREHSEVGSTMKTIEALSPGLYEMQIIDQEGEG-------------IGARFRVNFEERKTADIEA-IDDGRRREDMAFAAVNRLSELGGELYDLCLRPLIQSLVTPQSAAMLRAA 
50 rhiet-YP061     33.9%  SSRVINKEYNEVASTLEAIEALLPGLYEMRITDIQEDA-------------GHKSYSVELIERTFENIRE-F-NDGHDDGGPFAAVARVSELQAQIYHTVARPFVQAAVTDISADASRMF 
51 9rhob-b6yy40    36.0%  SSSVAKREHTQVASTLKTIEAMPPGLYKLQIEEQKGKG-------------CDAKFKVSFARKTIDEML--LETGERDEEKAFAGVARFSESWEDMYDSTIGPVLKTMNSSQTAEVTRDL 
52 metsb-b8eis0    42.4%  SAKVALKEHDRIVSTLDAIEALAPGLYEMQIEKLVSDA-------------TEPSYLVGFEERTLADLNA-F-DDGAEDE-AFEAVARLSEFGVDLYEMLLRPTIQALATPASAQAMARA 
53 legpa-q5x3d6    39.5%  SSEVAKKEHNQIIDLLNYIEHLAPGLYELKLNEIKENPK------------LPPHYLAYIEERSINDIRK----GQENNVAIFNLVRMVSEYNAMSYDLFMAPIIRNISNEYTAELIRKL 
54 azovd-c1dif2    30.8%  SGQVARREHRQLIGAIDAIKALPPGLFELIIDEVPHPD------------GGAQSYQVHFESRRIADILA--EDDGHDDEREFELVDRVSAISSTFYDWTVRPWLSRAINEPVAEQLREH 
55 pseu5-a4vhe6    34.3%  SGKVARREHRQLLGAIDAIALLSPGLYELMIDDLPASP------------SGDQAYQVHFEPRRIADILA-HDEDGRSDEREFALVDRVSGLNSTLYDWFVRPWMRRAINEPLAEFLRKS 
56 9gamm-c6n5e9    38.6%  SAKVVRLQHRAILEHSAAIEQLKPGLYEMIIVNPTGDP-----------DCSKEQYHVRFEERDITELCA------SNSTKPFEKIRQMSEANDSIYQSVAQPFVQKMSNPFLSWWLEKT 
57 legpn-Q8RNQ1    39.0%  SAKVVRLHHRAILEHGAAIEQLQPGLYEMIIVNPTGNP-----------DCSKEQYHVRFEARELTELCT------TSSTQPFDKVRQTSEANDSIYQKVIQPFVQSLSNPFLSWWLEKT 
58 9rhob-a6e5f6    39.9%  SGSVARLQHRAILESLDDVEALSPGLYEMVIDNPSGDP-----------DCETGDFEVRFEPREVDDLGI------ASDDAALKQVAQISRINEAVYSIFVSPWIRAATTPASAEALRAL 
59 9rhob-a9hui2    40.9%  SGSVARLQHRTILESLEAVEALAPGLYEMVFDIPSGGA-----------KRKTSDYDVRFVKRDVEDLGF------GSDHGALAQVAQISRINEAAYSTFVSPWIKAATSPASAEMLRAL 
60 acide-c5t1r9    41.0%  SAGVARLEHRAILESLAEIEALAPGLYEMKIDNPSGNP-----------DCHKPTYSIRFESRQVEDLKT------DYPQEAFERVKQVSTFNEVLYRAFVSPWAQTLSTPWTAEVLKWL 
61 acisj-a1w603    41.0%  SAGVARLEHRAILESLADIEALAPGLYEMKIDNPSGDP-----------DCHKPSFSIRYEPREVEDLKA------DYPEEAFERVKQVSTFNEALYRAFVSPWAQALSTPWTAEVLKWL 
62 aciet-b9mbf1    39.3%  SAGVARLEHRAILESLADIEALAPGLYEMKIDNPSADP-----------DCHKPSYSIRFEPREVGDLKT------DYPQEAFERVKQVSTFNETLYRAFVSPWAQSLSTPWTAELLKWL 
63 acisj-a1w9c9    36.4%  SAGVARLEHRAILESLADIEALAPGLYEMKIDNPSGDP-----------DCHKPSYSIRFEPREVKDLKT------DYPQEAFERVKHISTFNEALYRAFISPWVQSFSTPWTAEMLKWL 
64 burvg-a4jv42    39.3%  SAKVARLEHRAILESLEEIERLAPGLYEMKIDDPTGNP-----------DCHKPQYSVHFEERQIADLKL------GLHDAAFERVRQVSELNEQLYAAFVSPVIQAFTSPWTAAVLEWL 
65 brasb-a5eul1    41.3%  SGAVARFEHRAILEHVGEIESLSPGLYEMTIENPAGDP-----------ECRKPYYTVRFEPRRVEALHF------PDNRAALKRVQQISEATETLYRTFLSPWVQAVSNPWTADMAKWL 
66 metea-c5b1t3    38.3%  SAGVARFEHRAILESLGDLEVLEPGLYELKIDNPTGDP-----------DCRKPHYAVRFEPREVEAVRF------AYRRAPFEQVKAVSDTAEAFYSAFVSPWVRAFTNPWTVEATKWL 
67 meted-c7cfx5    39.1%  SAGVARFEHRAILESLGDLEALDPGLYEMKIDNPTGDP-----------CCRKPHYAVRFEPREVGALRF------AYQRGPFEQVEAVSDAIEALYRSFVSPWVQAFANPWSAELAKWL 
68 xanp2-a7ip61    37.6%  SAKVARLEHRAILESLPRIETLPPGLYEMKIDNPSGDP-----------DCREGAYQVRFEAREVSDIRF------ARQDPAFERVRDLSERNEAFYRTFVSPWVRALTTPWSAAMLETL 
69 xanp2-a7iq18    37.1%  SAKVARLEHRAILQSLPRIEALPPGLYEMKIDNPSGDP-----------DCRDGGYAVHFEAREVCDIRF------PRQDDAFERVRDLSERNEAFYSTFVSPWVQTLTTPWSAALLETL 
70 xanp2-a7ipv4    35.2%  SAKVARLEHRAILESLPRIEALPPGLYEMKIDNPSGDP-----------DCRAGDYTVRFEARQVSDIRF------AREDAAFERVRDLSERNEAFYRTFVSPWVRAVTTPWSAAALEAM 
71 rhopt-b3qg39    39.9%  SGAVAQREHRAILASMPEIERLAPGLYEMKIEEGGASD-----------NSSNLPFAVRFEPRQVEDLNF------PKPDPAFERIRDFSETAEAIYKTFFSPFVQATSNPLTAEMAKWL 
72 ralp1-c6br16    35.6%  SASVARHEHRAILQSLDAIEALPPGLYEMKLSEHSDAP-----------PQNNSQRGVTFEPRRVEDIQF------PYPRALFEHVRAVSEINERLYDQFWSPTVRALATPWSAEWLKWS 
73 polna-a1vvx2    40.5%  SASVAQHEHRAILENIERFKDLDPGLYEMKIGEPVEGQSVGGSGKRSGPDTPPAQHKVWFEERGIEDLQY------NYPRQAFEKVAAVSEWNELAYTTWVSPWIKWSANPVSAFMQKWG 
74 desah-c0qhm8    37.2%  SGKVSKKEHMEIISSIDLMEYLSPGLYEMVIRDDADPA-------------ETEAYTVKFEERTMDDILA-L-DDGALNEGDFRAVSAASNFNDTMYRTFVSPWVKAFTTPFSAELIRQS 
75 lepcp-b1xwq8    36.8%  GTDVARKEHDQIVTSLDVIDNLPPGLYEMKLELKDGSAP------APTDVLEPGSYSVHFEHRTMDHLRA-LNPEGREEEQLFSTVAKVSEINTGIYKTWMRPWVRPLASRALADAATDL 
76 azovd-c1djw3    20.5%  GARTLTERWPGIARWIAAQ----------------------------------------------------------------------------------------------------- 
77 beii9-b2igq5    16.8%  GTHTLKQAWPGIAAWIRTNGK--------------------------------------------------------------------------------------------------- 
78 burcc-b1k8j3    18.1%  GTRTLATVWPDIARWIAAQR---------------------------------------------------------------------------------------------------- 
79 burvi-q4bi33    17.8%  GSRTLKDTWPGIAAWIAQQR---------------------------------------------------------------------------------------------------- 
80 burvg-a4jv47    10.9%  GARTLSDTWPEIAHWISDCD---PGFH--------------------------------------------------------------------------------------------- 
81 metsb-b8ern6    13.5%  GSKTLKNFWPDIAAWIKRE----------------------------------------------------------------------------------------------------- 
82 braja-BLL4548   12.1%  GARTHAHAWPRIAQWLR------------------------------------------------DDLTG-------------------------------------------------- 
83 synww-q0axu9    11.1%  GTESLREDWTAVNEVLKLA----------------------------------------------------------------------------------------------------- 
   consensus/100%         ust.......th.t.......................................................................................................... 
   consensus/90%          uuthhphpatthht.ht.hc.h.sGhath.h............................h...thtth..............ht.ht.hu......Yt.hhtPhht.......s...... 
   consensus/80%          SutluppEHtthhp.lt.l-hLssGlYth.ltt...t...............t.ta.hphp.pplt-l..........tc..FthstthSphs.thYp.hhpPhlpthss...Athhp.h 
   consensus/70%          SutVup+EHpphhpslchI-hLsPGLYchhlpp.tsts.............htspa.lphc.+plp-ltt.......ts-t.FttVtplSchs.thYchhhpPhlpshss...Achhcth 

 1 9burk-b1g6q9   100.0%  HPLRLQRWAFSDL-NPWLAWLPSAASAVKTHRQP--AEADNPWRAIEQSGSQMISASLDYYREMRDAGTEATFFTIYGNLFSLYLADAK-P----AAESG--AKSGTGPDSDPRDLPFV- 
 2 9burk-b5wax2    67.4%  HPLRWQRWAVSAM-NPWLGWLPAAAQSVRDNRQR--AGADNPWSKLEHSGSQMISASLDYYREMRDAATEAGFFSVYANMYATFLGKAS-A----DGAAA--QAGA----INPRELPFV- 
 3 9burk-b5wqb7    65.1%  HPLRLQRWAFSDL-NPWLAALRPMADAVRASRQP--SSDLEPWRTAEQRGSELISASLDQFRAVRDASIEALFFSIYANLFAMHDPDLL-G----EQEAG--TSA-----ADPRSLPFV- 
 4 burs3-q391x0    67.5%  HPLRFQRWAFSDL-NPWLGWLKPAADTVKANRPP--ADDIEPWRKLERRGSDVVSASLDFFRAMRDASTESLFFTLYTQPFMLHFAEQY-R----DHHAA--SPAA----TDPRDLPFV- 
 5 cupnh-q0k0q7    64.5%  HPLRMQNWLFSDL-NPWMAWLKPAADAVRASRQT--LEPDHPLRQQEQVGAEMLSAGLDAYRAVRDAMTEYTFFNVYANLFPFQPRSEP------TARAG--TPAA----TDPHDLPEV- 
 6 cuptr-b3r4w6    64.6%  HPLRMQNWLFSDL-NPWMAWLKPAADAVRANRQA--LQPDHPLRQQEEAGAEILSASLDAYRAVRDAMTEYTFFNVYANLFPFLARSEP------AARAG--ATAA----TAPEELPEV- 
 7 cuppj-q472w1    63.6%  HPLRVQNWMFCDL-NPWMAWVSPAANAVRANRQA--LDADHPLRQREQAGAEVLSAGLDACRAVRDAMTEAIFFNVYANMCAFLPGDK-------TSRAA--RTV-----TPPRELPEV- 
 8 azovd-c1dgm6    61.2%  HPLRLQRWAFSAR-NPWLWWLAPAAAAVRKQRQAPVASRDDLPHHGERLASELISASLDHYRALRDAAGEALFFQTYGSLFSLILDESP-P----PAAS-----------AEAQELPFV- 
 9 metno-b8ihj3    46.9%  HPLRARRWALSDL-NPALASLGGWADLAKAHRVP--RDEAGPSVAAERRLAAGIMAGWDLYRQLRDATVENLFYNIYGTMSVVAPAE--------EPEAAV-AEA-----ISGRDAPAI- 
10 mets4-b0umc8    45.9%  HPLRARRWALSDL-NPALACLGPCADLVRGHRVH--RDEAGAWAASERGAAAGIMAGWDFYRQMRDAAVENLFFTVYATLSAVAPP---------GAEPAV-APS-------------ID 
11 xanp2-a7ikd9    37.9%  HPLRLARWGLSDL-NPHFPSKALIS----------------------------------------------------------------------------------------------- 
12 aroae-q5p962    32.4%  HPNRLGYRLLSDR-NPLTLSLPALAEKVRADRHP--VGEDNVFRRAETLVSEQIARGLDTWSDLRDKASEQLFMSIYGQPLLQVLVGLR-A-DGQPHRR---RPG-----TELEHRRFIQ 
13 chrsd-q1qx98    37.1%  HPIRLGYKLLSDR-NPLIAPIPVFAEHIRRHRQP--LADDNPLRQWEGMLASVIENGLKAYGEWRDRTGERLFLDIYGQPWLQALAGIG-P-DQARTRP---HPG-----RLPEHRQFLQ 
14 borpd-a9hzm8    35.2%  HPLRLPYELISDR-NPWVAPVTQVAEQARQHRQP--AAPDNPYTVLERMASNAIEASLNIWQELRDAAGEQLFMNIYGSPLVQNWAGLG-A-KVGPPRK---HPG-----VSPEHRQFMA 
15 borpe-q7vzb4    34.5%  HPLRLPYELISDR-NPWVAPVAQLAEQVREQRQP--AAPDNPFWALQKMASDAIVAGLDIWRDLRDSACERIFMATYGSPLVQDWAGLG-A-KDGPPRR---HPG-----VSPEHRDFMA 
16 burp8-b2jmm5    35.0%  HPLRVTYELWSDR-NPFASSVARAAASVKEARAP--VAEDNPFMQMQTAMSNAIIASLDYYRDMRDAAVEQAFETIYGAPWLQAFAGLPPQ-SDSAANAALTEPG-----DTEERDASIV 
17 ralso-b5s536    35.4%  HPLRVPYESWSDR-NPLTSSVARAAESVRAERAP--VVADNPFWQMQNAVSNAIETSLDCYRDMRDAAVEQIFETVYSAPWLQAFAGLPPH-GDREANTTLDAPG-----DTEEREAAIV 
18 burvg-a4js32    35.6%  HPLRVGYEWWSDS-NPLAAWVSAVAGDVRANRTQ--VLADNPAWQAQERVSDAIEAVLDQWRDLRDAAYEQTFEAVYGSPWLQALVGQRAA-DDRPPRP---YPS-----VSPEHRQFVD 
19 comte-b7wqc8    31.9%  HPLRVGYELWSDR-QPLAAAVQEAAQHVREHRQP--VAEANPFLQLQAQFSTALEQTLDQFRDCRDRIYAQAFDTLYSLPLVQAMTGQSLH-DEAPPRA---HPS-----ETPEHRQYLA 
20 parl1-a7hyr7    36.3%  HPLRMGYELWSDR-HPLAAAVHEAAQHVRDHRQP--VSEANPFLQLQAQFSAAVEQMLDQFRDCRDQIYAQAFDTLYSLPLVQAMTGQSLH-DDAPPRP---HPS-----ETPEHRQYLA 
21 delas-a9brz2    33.6%  HPLRVGYECWSDS-HPLAPVVAQAAEHAREDRHP--VEPDNPFLKAQQAMSQAVVHLLDTYRDQRDAMQARLFHAIYGSPLVQALAGQSRQ-DDGPPRP---HPG-----ESPEHCQYMR 
22 nitec-q0ajy0    34.3%  HPLRLSYEWWSDH-NPLAPLVADTAKKIREQRAP--ISEDNPFLQFQGIWSDAIVKTLNLWRDARDDACEKAFEWTYSSPWVQALAGQS-G-DDEPMRQ---RPS-----VTPEHRAFVA 
23 comt2-d0j233    35.2%  HPMRLQFEAWSSQ-HPLACLIRSSAEFIRGHRQP--VDEANPWLHMQQRCSAALDRALDDFRDRRDHIYALWFDMLYGSPLMQALAGHAYG-ESAAVRQ---HPG-----STPEHLALMA 
24 comte-b7x1q8    33.0%  HPMRLQFEAWSSQ-HPLAALIRGSAGYIREHRRP--VDEANPWLQMQQQGSAALERSLDDFRDRRDHIYALWFDMFYGSPLMQALAGHAYG-ESGPVRQ---HPG-----TTPEHLALMA 
25 beii9-b2iia7    35.6%  HPLRLQYEIFSDA-NPMMAWIPGLAKQVRENRKP--VAKDNPLISLQEMASNQIVNALDAWRDTCETFAEQWFLTIYGSPMLQAALGID-Q-EPRPWRK----AP-----KSQLHRELLQ 
26 braja-BLR3456   35.2%  HPLRLQYEALSSQ-NPWMTAVKSAAEDIEDNRKP--VAQDNPFLAFQEQMSKQIVHALDSWRDAQEALSEAIFLNLYGSPAVQTALGID-P-KSEPSRR----RE-----MSAEHRAMLE 
27 nithx-q1qpw8    35.6%  HPLRLQYEAFSSQ-NPLMSAVKSLAEQVNEDRKQ--VSTGNPFVAFQEQVSKQIVHALDIWRDSQEALSEATFLAVYGSPALQAAVGID-P-QSAPSRP----QE-----MSAAHREMLD 
28 rhime-yack      35.5%  HPLRLQYEVFGPG-NPVMAWVEAAAGLIRDARQP--VAPDNPLLALQENMSRQVVDGLEAWRQMVEHLSEQKFREIYGAPALQAALGIDTQ-TDRPPRQ----AA-----KNCWHHALLE 
29 rhisn-c3krv5    36.8%  HPLRLQYEIFGPS-NPLMAWIEAAAEHARENRKP--TAAENPFLALQENMSRQIVDGLEAWRRTVEHLSEETFRAVYGAPVLQTALGID-S-KSDRPRK----PA-----KSHLHEELVK 
30 brasb-a5eg29    36.4%  HPQRMQYALFSNL-NPLVKPIAELAEQIRTHRSP--VSADNPFLLAQEAVSGQIVSALDAWRDHQEKLSESIFLAVYGSPVLQAAVGID-R-TAAVSDR----PV-----ESQLHRELLQ 
31 azos1-d3p281    36.0%  DPYRLRFAAFSDR-NPLMALVPPLAEAVRAHRRP--VPVDNPLLGLQKAISEQIVLALDMARDVRDRATEGFFLTVYGSPQLQTLLGIDPN-RPVPGHG---RPG-----RDLTREAAIL 
32 beii9-b2icg9    36.5%  HPNRLRYAFFSDR-NPWLRPVKALAEHVRANRHP--VTKDNPFVLLEQGLSNTIISTLENYGHWRDTLEENFFLTFYGSPTLQALLGLG-A-DPTRPPR---QLG-----REVTREAIAN 
33 metsb-b8ert2    37.3%  ERNRLRFSAFSSK-NPLMQPISALAETVRSHRAP--VRADNPFLAGERAFSEAMTASLEAFGKARDTLTENIFLSVYGAPLVQAIVGLD-P-SEIRPRQ---GIA-----HDLAHEAATA 
34 azosb-a1k5s0    35.9%  NPARFERLWFSDA-NPLLWPLAPIAGLIAHKRVP--ASDDNPFVQLEKQVSGQIEQSLNHYRDSRDHLQEQLFTTVYEAPLLQALVGLG-Q-GVVRRRE----QA-----HTWMEDEFRN 
35 chrvo-q7nwh6    35.3%  HPARFERTLISPR-NPWLWWLPGLAAKVREQRRP--VSQDNPLWQWQEQVSDFIVQSLDHYRDLRDAAQEQLFRSIYESPQLATLVGVAPA-G--EPRSQ--A-------LAWETRELAR 
36 chrvo-q7p1c7    36.6%  HPSRFERRWFSSR-NPLLTGMAEWADKVRAARKP--VSEDNPFWQWQQTVSDWTASLLDGWRDQRDAVKEMTFRAVYDAPLTAALVGLHPR-RPYRLRSH--H-------GGWERKEMLR 
37 cupnh-q0kdv2    38.9%  RPARLERELATDV-NPWMAWIGALAPLVREHRAP--VSADNPLLTLEHAASAQIVSALDQFRDLRDAWYERAFEAIYASPAMAALVGLRAP-APVNLES----PV-----TVALRKELAA 
38 cuppj-q475c4    38.4%  HPSRLERSLATDN-NPWMAWIRALAPMVREHRQP--VAQDNPFLTMERAVSAQIISALDQYRDARDAWYELAFETLYQSPMMAALVGMQAQ-APVNLES----PV-----TVQLRKELAQ 
39 ralme-q1lqx6    41.4%  HPTRLERSLEGDT-NPWMQWVSAMAPAVREARQP--VSPDNPFLAMQTAISDQIVRSLDLYRDMRDAWQEQAFSSIYATPWLPALFGMKVD-TE-RAES----PA-----VSALRTEVAE 
40 acicj-a5ft95    35.2%  NPLRLSYTIFADR-NPWMQVVRTMAAGVDAARRP--VAADNPFLALQTQVSDQIIAGLDAYRAARDVMAEQVFFGVYGSPFVQALLGIT---DRTEARP---TPG-----PSPEQRALQE 
41 azoc5-a8ih86    33.7%  NPLRLSYSLFADS-NPFMKPVAKAAAEVTAARKP--VPPDNPFLAVQKLWSDQISAGLDAFRDLRDRAVEQAFFGIYGSPVLQGMLGLN---LDEKVRE---LPP-----TSPQKRAFLT 
42 azosb-a1k696    41.1%  HPLRVQRRAWSDL-NPWLWWVPVARERLGEGPE---VGEANPWLSWETALSDVVEAGFDTVRDVRDAMLETLFHSIYGALDALGAGDRL-A----KARLF----------SAGGAEDVA- 
43 9rhob-a0p290    35.6%  HPLRMQRALFSSL-NPALGWLPGIAERARNERSP--ASAGNPFVELEKVNAALIEQSMDLFRDLRDTAYENLFYSIWGTPYMRWFGRSK-Q----PGRTL--KRK-----DELRSLPPV- 
44 9rhob-b9r693    36.5%  HPLRVQRTMMSSL-NPMFGGLPGMAERVKEDRTP--ADANNPFSEMERVSAAMIEQSLDLFRDLRDTWYENLFYTVWGSPYMRWFGRTH-Q----PGRTL--KRK-----EDLRSLPPV- 
45 meted-c7cnd9    37.5%  HPLRLQRRMMSTQ-NPLAAPLRMMADVVKPSRRE--LPVGNPFASAEAMMADMFAQSLDLFRDMRDMAYEQMFFSLWHSPWAQNYGKPH-D----LHRTL--ESA-----AELRALPEV- 
46 brasb-a5ef53    38.5%  HPARLMRRGFGGD-NAMTHAIRKAADEARAARTK--AGPSNPFLALEQFWAKSVVQAFDVFRDVRDSLYEATFLSIYSSPLMDAIASTH-A----FQRVH--REP-----KELRFLPEV- 
47 braso-a4z1h1    38.2%  HPARVTRRAFGGN-SAGAQAIRKAAEQARAERAL--AAPDNPFLALEQLWAKSITQAFDVFRDVRDTLYEAAFLSIYSSPLMDAIASTH-A----FQRVH--REP-----KELRFLPEV- 
48 rhop5-q07lt7    39.2%  HPARAQRLALSDR-NPFMAWVEPMAKAVSDARAA--VPASHPFRQFEQIWSDSVEQGLDLMRDMRDACYETMFFGIYSSPMMRAVGQSH-A----FQRTL--KDP-----TELRFLPEV- 
49 metsb-b8eqs6    37.0%  NPVRLRRALFADR-NPAMPVVAALASQVRAGRKP--ADAANIFRRTEALWMQSAGQAIDFHRDLRDAWNELIFFGLYASPLMQWVGRTH-N----FQRTR--KDP-----AELKSLPEV- 
50 rhiet-YP061     33.9%  HPKRLERSLLSSQ-NPIMVGYKSISEQVRNSRAN--AAAENPFLAAEALYFKAVEQAIVVMRDWRDMGYELAFHMIWNNPWQRYFDNPH-E----AYRKG--TTL-----DDMRWQPDI- 
51 9rhob-b6yy40    36.0%  HPMRLANGAFAST-NPFMFWPTMAAAAVKQNHKP--NMAKTPFHYWEEIVADSIEYGWDALKDMREAMIENSFLTFWASPQAVEYG