Reference sequence (1): 9burk-Q5YEW3
Identities normalised by aligned length.
Colored by: consensus/70% and property
1 9burk-Q5YEW3     100.0%  ---MRSIRLKRLIAAVAL---GGAAAATQAASP------LPRLNVDKTQISVSGLSAGGFMANQLGYAYSGTF-MGVGIFAGGPYMCAGHSNYTS---CMYNATITSSMRSAMQASIDNW 
2 calma-PHAZ        70.1%  -----------MKTRMLV---GWAAAAVLAAGPAWAVQSLPRLNIDKSQISVSGLSSGGFMANQLGVAHSSTF-MGVGVFAAGPYMCAGHYNYTA---CMYNATISDGQLSTMQSSINHW 
3 comte-PHAZ        63.2%  ---MRVQSWRSGVAALALW--GGVNLAAGAAVP------LGQYNIATDQISVSGLSSGGFMANQLGNAYSASF-MGVGIFAAGPYMCAGLNNYTA---CMYNASISSAQLNAMQSSIDSY 
4 9euro-a0a421cwa8  46.2%  ------MPTFATFLGLAMS--GAASVSAAA---------LGAYNVDPNSISVSGLSSGGFMSAQLGVAYSDTFKVGFGVFAGGPYDCARSQSYTT---CMYNQSPS---ITTPVANMKSW 
5 penfu-PHAZ        45.4%  ------MFDSVKIAWLVAL--GAAQVAATA---------LPAFNVNPNSVSVSGLSSGGYMAAQLGVAYSDVFNVGFGVFAGGPYDCARNQYYTS---CMYNGYPS---ITTPTANMKSW 
6 acisp-Q9ZNH8      42.4%  -MAFNFIRAAAAGAAIALC--GVASVH--AAVN------LPALKIDKTQTTVSGLSSGGFMAVQLHVAYSATFAKGVGVVAGGPFYCAEGSVVNATGRCM--ASPTGIPTSTLVNTTNTW 
7 comac-PHAZCAC     42.7%  -MAFNFIRAAAAGAAMALC--GVGSVH--AAVN------LPALKIDKTQTTVSGLSSGGFMAVQLHVAYSATFAKGAGVVAGGPFYCAEGSIVNATGRCM--ASPAGIPTSTLVSTTNTW 
8 strex-PHAZ        31.8%  MKIRQLLVAALTAVGIAATTVGGATAAVPAPTP----GSLQQYNI--GSTYVSGLSSGGFMANQMHVAYSDVF-EGAGIFSAGPYDCAQNSVNTAQYACMDTFMARKTPAQLEQLTRDRA 
  consensus/100%           ...........hhhhhhh...Ghstht..A.........L.thpl..sph.VSGLSuGGaMusQht.AaSssF..GhGlhuuGPa.CAt....ss...CM.....t...hph...shpph 
  consensus/90%            ...........hhhhhhh...Ghstht..A.........L.thpl..sph.VSGLSuGGaMusQht.AaSssF..GhGlhuuGPa.CAt....ss...CM.....t...hph...shpph 
  consensus/80%            ...........hhsthsh...Gsusst..A.........Lsthpls.sphoVSGLSSGGFMAsQLtsAYSssF.hGhGlhAuGPa.CAttp.hsu...CM..t..s...hss..sshppa 
  consensus/70%            ......h.hththsulAh...GsAssus.Asss......LsthNls.sphoVSGLSSGGFMAsQLtVAYSsoF.hGsGlFAuGPY.CAttpshTu...CM.suo.ot..hos..uohssW 

1 9burk-Q5YEW3     100.0%  -SGAHIDPKAHVANQRVFLFVGNSDTTVGPNPMDAVHAQYQHNGV-RRTARVRGRNSTAHVFPTDFDATGNNACNSTASPYIANCGYDGAKAVLSRIYGTLQPRNDAPA-GANYIEFDQT 
2 calma-PHAZ        70.1%  -SGSQIDDKAGIAKQKIYLFVGTSDSTIGPNPMDALRKQYANNAVPTGNDEYIKRSGAAHVFPTDFDAAGNNSCGSTSSPYIANCGYDGAKAVLTRIYGTLNPRNDTPP-ASNYIEFSQA 
3 comte-PHAZ        63.2%  SSAASIDAKSRIAAQKIYIFTGTSDYTVGPNLTDALQTQYLNNGVPQGNIAYVKRSGAAHVLPTDFDSSGNNACSSSASPYISNCGYDGAKAALTHFYGALNPRNDAPA-TGNYIEFNQA 
4 9euro-a0a421cwa8  46.2%  -SGNQINPVSNLQSRKIYMWTGSADTTVGPNVMSQLKAQLANFDT-AANVSYITTSGAVHTFPTDFDASGDNSCSSSVSPYISNCQYDGAGAVLKWMYGSLNARNTGTL-SGSIVSFSQT 
5 penfu-PHAZ        45.4%  -SGNQIASVANLGQRKIYMWTGSSDTTVGPNVMNQLKAQLGNFDN-SANVSYVTTTGAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGAALKWIYGSLNARNTGTL-SGSVLSFAQ- 
6 acisp-Q9ZNH8      42.4%  AGQGVIDPVANLQNSKVYLFSGTLDSVVKTGVMDALRTYYNSFVP-AANVVYKKDIASEHAMVTD---DYGNGCSTKGAPYISDCNFDLAGAMLQHLYGTLNARNNATLPSGNFIEFNQS 
7 comac-PHAZCAC     42.7%  ASQGVIDPVANLQNSKVYLFSGTLDSVVKTGVMDALRTYYNSFVP-AANVVYKKDIAAEHAMVTD---DYGNACSTKGAPYISDCNFDLAGAMLQHLYGTLNARNNATLPTGNYIEFNQS 
8 strex-PHAZ        31.8%  -TAGKVDPVANLSGDKVWLFHGTNDSTVKAAVNDDLATYYRDF---GADVVYDNSSASGHAWVSP---LGPNSCSSTTSPYVNTCGGDPVRDMLTHLLGSVNPASSSAL-TGKLVQFNQS 
  consensus/100%           .sts.lsshutlttp+laha.Gs.D.sltss..stltt.h.p....tts..h.tp.us.Hshsos....hsNuCs.psuPYlssCthD.stshLphhhGslpstssss..suphlpFsQ. 
  consensus/90%            .sts.lsshutlttp+laha.Gs.D.sltss..stltt.h.p....tts..h.tp.us.Hshsos....hsNuCs.psuPYlssCthD.stshLphhhGslpstssss..suphlpFsQ. 
  consensus/80%            .ots.IsshuplttpKlahasGo.DosVtssshstLps.hts.ss.tuss.Yhpp.uu.HshsTD...shsNuCuopsuPYIusCsaDhAtAhLphhYGoLNsRNsush.sushlpFsQs 
  consensus/70%            .SuupIDshAsltspKlYlFsGosDoTVtsslMDsL+s.Yts.ss.suNlsYhppsuusHshsTD...sGsNuCSoosSPYIusCsaDsAtAhLp+lYGoLNsRNsush.oGshlpFsQs 

1 9burk-Q5YEW3     100.0%  AFTN-----NPGMASTGWVYVPANCAAG--AQCRLHVALHGCQQSTGHIGDRFVKNTGYTRWADTNNIIVLFPQAKTDNT-PRNTAASGMLPNPNACWDWVGWYGSNFAQKTGTQAAAIK 
2 calma-PHAZ        70.1%  SFTN-----NPGMAATGWVYVPSDCAAG--AQCRLHVALHGCQQSYAQIGDKFIKNTGYTRWADTNRIVVLFPQTKVDNT-SRSTAASGLLPNPNACWDWIGWYGSDFAQKGGSQISAIK 
3 comte-PHAZ        63.2%  SYTNA----NPGMASTGWLYVPQSCASG--TQCRLHVVLHGCQQSTDKIGDKFVRNTGFSRWADTNNIIVLYPQTQVDNN-NRSTSKSGSLANPNACWDWIGWYGNNFAQKSGVQMTAIK 
4 9euro-a0a421cwa8  46.2%  GEYG-----ASGMDTTGYLYVPKACQSGSATVCKLHVALHGCLQSYSMIGSDFVSNTGYNMWADTNNIIILYPQAVADNT-MHTVWTGMSLPNPNGCWDWVGWYGANADQLGGVQMAAIV 
5 penfu-PHAZ        45.4%  GSYG-----ANGMDTTGYLYVPQSCASG-ATVCSLHVALHGCLQSYSSIGSRFIQNTGYNKWADTNNMIILYPQAIPDYTSIHAIWNGGVLSNPNGCWDWVGWYGSNADQIGGVQMAAIV 
6 acisp-Q9ZNH8      42.4%  EFIS-----NHGMATTGWAYVPQACQAGGTATCKLHVVLHGCKQNVNDVQQQYVRNTGYNRWADSNNIVMLYPQT--------------SLAATNSCWDWWGYDSANYSKKSGPQMAAIK 
7 comac-PHAZCAC     42.7%  EFIT-----NHGMATTGWAYVPQACQAGGTATCKLHVVLHGCKQNIGDVQQQYVRNTGYNRWADTNNIVMLYPQT--------------STAATNSCWDWWGYDSANYSKKSGPQMAAIK 
8 strex-PHAZ        31.8%  GYAPGGSAGAISMGNEGFAYVPQSCQSG--ASCKLMVTLHGCYQYFGLVGNALMDKAYLNEYADTNDMIVLYPQATT------------MTGNPRGCWDWWGYKSADYAQKSGPQMTAVM 
  consensus/100%           t.hs.....s.uMsspGahYVPtsCtuG..s.CpLhVsLHGC.Q.hs.ltpthhppshhs.aADoNphlhLaPQs...............hssspuCWDWhGa.usshsphsGsQhsAlh 
  consensus/90%            t.hs.....s.uMsspGahYVPtsCtuG..s.CpLhVsLHGC.Q.hs.ltpthhppshhs.aADoNphlhLaPQs...............hssspuCWDWhGa.usshsphsGsQhsAlh 
  consensus/80%            t.hs.....s.GMssTGahYVPpsCtuG..s.C+LHVsLHGC.Qshs.ltppalpNTGascWADTNshlhLaPQs...............hsssNuCWDWhGa.uushsphuGsQhsAIh 
  consensus/70%            uahs.....s.GMuoTGahYVPpuCtuG..spC+LHVsLHGC.QshuplGspalcNTGYs+WADTNNIllLYPQs.s.............LsNPNuCWDWhGahuuNauQKuGsQMuAIh 

1 9burk-Q5YEW3     100.0%  AMVDHVAS---- 
2 calma-PHAZ        70.1%  AMVDHLASG--- 
3 comte-PHAZ        63.2%  AMIDRIASGA-G 
4 9euro-a0a421cwa8  46.2%  NQVARIVSGY-- 
5 penfu-PHAZ        45.4%  GQVKQIVSGFQG 
6 acisp-Q9ZNH8      42.4%  AMVDRVGSGG-- 
7 comac-PHAZCAC     42.7%  AMVDRVSSGT-- 
8 strex-PHAZ        31.8%  NMARALGAG--- 
  consensus/100%           s.httlsu.... 
  consensus/90%            s.httlsu.... 
  consensus/80%            s.lcplsSG... 
  consensus/70%            uMVc+luSG... 

MView 1.56, Copyright © 1997-2013 Nigel P. Brown

#protein: highlight amino acid physicochemical properties
hydrophobic          =>  bright-green      { A, G, I, L, M, P, V }
large hydrophobic    =>  dark-green        { F, H, W, Y }
cystein              =>  yellow            { C }
negative charge      =>  bright-blue       { D, E }
positive charge      =>  bright-red        { K, R }
polar                =>  purple            { N, Q }
small alcohol        =>  dull-blue         { S , T }
any       => dark-gray                     { X }
#protein consensus: report conserved physicochemical classes, derived from the Venn diagrams of Taylor W. R. (1986).
# The classification of amino acid conservation.
#J. Theor. Biol. 119:205-218.
alcohol          =>  o       { S, T }
aliphatic        =>  l       { I, L, V }
aromatic         =>  a       { F, H, W, Y }
charged          =>  c       { D, E, H, K, R }
hydrophobic      =>  h       { A, C, F, G, H, I, K, L, M, R, T, V, W, Y }
negative         =>  -       { D, E }
polar            =>  p       { C, D, E, H, K, N, Q, R, S, T }
positive         =>  +       { H, K, R }
small            =>  s       { A, C, D, G, N, P, S, T, V }
tiny             =>  u       { A, G, S }
turnlike         =>  t       { A, C, D, E, G, H, K, N, Q, R, S, T }