Reference sequence (1): 9brad-q35fu4
Identities normalised by aligned length.
Colored by: consensus/70% and property
 1 9brad-q35fu4     100.0%  -------MAKLKTVGASRP-----------------DPR----RREGNAESGPAVAVTTKASATALAATG--GTLPLRQEDE------------------------------DSDAFRRE 
 2 braja-bll6073     67.5%  -------MSVVKVFP--------------------------------RAEEPPAQALPANSAAEAPATIP--ERIPEKPV-------------------------------VANSLPASE 
 3 rhop2-q2j0d2      58.1%  -------MPQTQAHA-----------------------------------------------------------LPVESHPA------------------------------QAPAKHSA 
 4 rhopa-q37lc6      57.8%  -------MLQTPSNP-----------------------------------------------------------IAV---AP------------------------------QAPVRHVG 
 5 rhopa-q6n209      58.2%  ------MMLQTSPPA-----------------------------------------------------------PSAASQQI------------------------------QSPARHHG 
 6 rhopa-q374l7      60.8%  -------MDPPRSAK---------------------------------LATDPAARELSRSAADAD----------------------------------------------AASAEAPG 
 7 rhopb-q20z62      59.2%  -------MSQPQVAA-----------------------------------------------ALAPD-------VPTEVAIS------------------------------PGEAEGSA 
 8 9brad-q355g0      50.3%  -------MNDTSKTP--------------------------------------SLEGEARVTTEPVQADF--HTRPADASHD------------------------------KDRASDVA 
 9 hahch-q2spi5      50.1%  -------M--------------------------------------------------------------------------------------------------------DDSSLFAE 
10 9gamm-q34zq5      49.9%  -------MTHDKV---------------------------------------------------------------------------------------------------ERVDTGRG 
11 ectha-q2cqy0      49.3%  -------MVHSL--------------------------------------------------------------MP------------------------------------EFEESERE 
12 9gamm-a0a265du41  54.3%  -----------------------------------------------------------------------------------------------------------------MLLDDTQ 
13 silpo-q5lws0      49.7%  -------MGQARLKA----------------------------------VNTPRELGAKTGSGGKPLTPPISLDSPKQKTGS------------------------------KPYPDTGL 
14 aroae-q5p115      51.8%  -------MNMNMRNP-----------------------------------------------------------SPATPP-------------------------------TIPESPSSS 
15 burma-q62eb8      52.8%  -------MDTRHAPE------------------------------------------SGAPDAPLPA-------HPP-----------------------------------ASYAPESP 
16 pardp-a1b9s7      44.4%  -------MTHKVNTPEAG----------------------------------------------------------------------------------------------PAGTDTAP 
17 pardp-a1bcb9      50.2%  -------MKTPTSAP-----------------------------------------KPAVASAELPP-------VPC-----------------------------------PEPLGREA 
18 xanp2-a7igw0      49.5%  -------MPLETRVPSLS-------------------------LVPTAPSEAPSDVTPKAGPAAPPSSAPPASVLPASGTQRPAMDFSRLPESARMLAQTWARLTCQDDEDFEKGSGPEA 
19 brasb-a5esl7      49.2%  -------M-------------------------------------------------------------------PEVNSQT------------------------------ATDPLDGL 
20 acicj-a5g2y8      50.5%  -------MTTETSRS-----------------------------RTTGHAKPPAEAARARVSALPPP-------APPASV--------------------------------APNEPVST 
21 rhos4-q3iye8      47.5%  -------MSDMK---------------------------------------------------------------------------------------------------WNAEGAPAY 
22 9gamm-a0a265dzk1  47.5%  -------MLKRP-----------------------------------------ATTCTDEVAADTNR-------SG------------------------------------AKASPPSL 
23 9burk-q4b3g8      45.9%  -------MALSN----------------------------------------------------------------------------------------------------PRPEGQHA 
24 9burk-q3fd95      45.0%  -------MKASVTRA-------------------------------------PRGNESIRPSGAVEP-------ESSATQ--------------------------------CPQAGTTP 
25 burvg-a4jsh6      43.9%  -------MNAPAMRA-------------------------------------PLAQEAIRLPQPNEP-------APCALA--------------------------------TAPADATP 
26 ralme-q1lcz5      44.1%  -------MRPKKPVALEHTTDTLIEQAPPAKRAKATSPKPSTSTPSVPAARKTAASAPAKLGPAASP-------APAVAT-------------------------------CPEPPPLRP 
27 legpa-q5x2r4      44.6%  MPGMLRPMKGSEKQC---------------------CPKE---RILTQSQELQEGVDFS--------C-----CAPA-----------------------------------DMSTSDNF 
28 legpa-q5x3j6      45.2%  ----MSAMKGLEKQC---------------------CSKE---RILTQSQELQEGGDFS--------C-----CVPV-----------------------------------ESTSSNSF 
29 legph-q5zwi8      45.9%  -------MNGLEKQC---------------------CPKD---VILTQQEKASESLSV---------C-----CAPS-----------------------------------ILGASDSF 
30 legpa-q5x322      43.7%  -------MKKTTEKP------------------------------INKTKEMPASSKKEILNP-LEQ-------TP------------------------------------SLEQSDPI 
31 rhofd-q21u70      42.1%  -------MKKSIPLP------------------------------------------------------------P------------------------------------PTERQLAA 
32 9gamm-q350p6      31.8%  -------MAGDDKPGHR------------------------------------------------------------------------------------------------------- 
33 aroae-q5p0w7      31.8%  -------MDSVRNAKPSG--------------------------------------------------------------------------------------------------PLTP 
34 decar-q47hd2      31.4%  -------MSSNSTEKHNG----------------------------------------------------------------------------------------------VNIHSLSP 
35 hydte-a0a2z6dwt1  30.0%  -------MKTLQ----------------------------------------------------------------------------------------------------------ST 
36 rhoru-PHBCRR      30.1%  -------M---------------------------------------------------------------------------------------------------------------- 
37 9sphn-q2n9u1      25.8%  -------MAVE------------------------------------------------------------------------------------------------------------- 
38 rhoco-PHAC        26.2%  -------M--------------------------------------------------------------------------------------------------------MAQARTVI 
   consensus/100%           ........................................................................................................................ 
   consensus/90%            .......M................................................................................................................ 
   consensus/80%            .......M................................................................................................................ 
   consensus/70%            .......Mt.............................................................................................................s. 

 1 9brad-q35fu4     100.0%  DHELDKAFSAVLARMTAGISPA------ALSMAYLDWACHLAAAPQRQMENVHNAWQMARQLAERSLHLAD--PNRL-PWDLIKPQPNDHRFSKPQWAMQP-FNLLAQSFLLGEDWWHKA 
 2 braja-bll6073     67.5%  PYPFDRAFHAVLARFTGGISPV------ALSLAWLDWSTHLAAAPERRMQMFRNGLRDTGMLLQAVAHAT----SQK-PWSVIEPQGRDRRFKDPQWETAP-FNLLAQAFLLSERWWHDA 
 3 rhop2-q2j0d2      58.1%  PNDSDRALHATLAPLTGGLSPT------ALSLAYADWLAHLFWAPARRLDLAHDALRRASQLAEAAVK------PGP-PWALIAPQPQDRRFAGPEWLQPP-FNLMAQGFLLTEEWWHDA 
 4 rhopa-q37lc6      57.8%  STDSDRSLHAALAPLTGGLSPT------ALSLAYADWLSHLFWAPARRLDLAQDALRGAAQLAQAAVH------PAP-PWSLITPQPQDRRFAGPEWRQPP-FNLMAQSFLLAEEWWRDA 
 5 rhopa-q6n209      58.2%  PSDSDRTLHATLAPLTGGLSPT------ALTLAYADWLSHLFWAPTQRMDLVNDALRRGTQLAEASIG------QTA-PWSLIAPQPQDRRFSAPEWREPP-FNLMAQGFLLAEQWWHDA 
 6 rhopa-q374l7      60.8%  SDAADRMFHASLARLTGGISPA------ALWLAYTDWLIHLAAAPARRLDIAQAATQAARRFAEAATQR-----IAT-PWASIQPPPQDHRFAGAGWDLPP-FNLLAQGFLLTQAWWHQA 
 7 rhopb-q20z62      59.2%  SERADRLFHAALARLTGGISPA------ALRLAYTDWLLHLMSAPARRLDIAQAAMHAAGQFAAAAARL-----PET-PWASIKPQPADRRFAGPGWELAP-FNLMAQGFLLAQQCWQTA 
 8 9brad-q355g0      50.3%  WRSIDRVFKARIGRLTAGISPV------GLSEAYFDWFGHLWMSPGKQAQLVEKAWRKAGRIGLYWMRCIS---ASN-PSPCIDPLPQDDRFVAEEWQQWP-HKLIYQNFLLHQQWWHNA 
 9 hahch-q2spi5      50.1%  SKAIDRLLHAFIGYGTGGNSPA------AFIQAYTDWVSHAVMAPGKHAELAKNISRNLLRYGVYCSRTIT---NQN-PEPVIAPLPQDIRFRNEEWGRFP-FNLAYQWFLLYEQWWHYA 
10 9gamm-q34zq5      49.9%  AHPIDRLLHAGMGRVTGGLSPA------SLGLAYVDWAIHMGISPGRQTELVEKAWRKATRLSLYAMRCAAN-GAER-HPPCIEPLPQDTRFNASQWQRWP-FNVWYQGFLLTQQWWHVA 
11 ectha-q2cqy0      49.3%  ALTADRLFNAGLGRYTQGLSPA------AVSLATFDWAVHLATHPGKQFALMDEAMRNAMRYNAYVFSRMT---GTC-PEPCAKPWPGDDRFSAEQWQRFP-YDVLEQGFLLTQQWWHSA 
12 9gamm-a0a265du41  54.3%  HDSLDRFVRASLARLTLGISPA------SVVLTYLDWLSSLALSPGSQAHLGQKAVKKQLRLVQWASHSAF---DPN-AAPCIDPLPQDRRFKDPAWRHFP-FNVLYQSFLLQQQWWYNA 
13 silpo-q5lws0      49.7%  PEFLDRALKARMARVTKGLSPA------ALAGAYLDWIVHLATSPGKQIELSENAYRKWLRLSRHAATCSV--NSND-TAPCIEPLPQDRRFRSDAWQKWP-YNLIYQSFLLNQQWWYNA 
14 aroae-q5p115      51.8%  RNPLDIKVHAALARATSSISPM------SLLLASIDWAGHLAGSPGKRLELVNLALEQNRRLVRYIRELALALPASP-AHECIEPPARDRRFIADEWHHWP-FNLMHQSFLLADEWWQAA 
15 burma-q62eb8      52.8%  YRIFDLAKEASVAKLTSGLSPA------SLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAAT---GRT-PAAPAQPSPGDRRFRAGAWQLEP-YRFWHQSFLLAEQWWRAA 
16 pardp-a1b9s7      44.4%  YRTIDRLREAMAAGFGTGVSPL------ALGMALIDWSAHLAAAPGKRLELADRAARETAELMAHIAALAT---DPK-AEPVIRPGPQDRRFAAAAWQNPP-FSIWVQGFLLARQWWHEA 
17 pardp-a1bcb9      50.2%  FRTFDRMREAMTAQFTGGLSPA------ALTLALQDWTMHLAAAPGKRMELLDKANRKAARLLCHLAALCV---NRE-APACIDPLPGDYRFAAEGWKKPP-FSIWAQAFLLQQQWWHNA 
18 xanp2-a7igw0      49.5%  FRAVDRAAAALVARATSGLSPA------ALSLAYLDWWMHLAAAPGKQAELGLKAWRKAARFGSYAVASSF---DRT-FPNCITPLPGDERFSAPVWQDWP-FRLWYQAFLLNQQWWHNA 
19 brasb-a5esl7      49.2%  SETLDRATTAAFAQVTFGLSPV------TVAQAFSDWGLHLAVSPGKQLQLGAKAMRKCLRLADYAARSAA---KND-AERAIEPLPQDRRFADTAWATPP-FNLISQAFLLNQQWWHAA 
20 acicj-a5g2y8      50.5%  TDALDRSLHAAEARLTAGLAPA------GIALAWRDWAVHLANQPTRRMDLARRAMEDWAAVWRVAFGL---------EEAVTPPCDNDHRFDHPRWQDMP-YRLYKEYFLRMERWWHDA 
21 rhos4-q3iye8      47.5%  GQALDRAARAAIAGMTRGLAPS------VLATAALDWMMHLAAAPGKQAELWEKAATASAALMQAGLQ-------------PHEAPVRDRRYASEAWSRQP-FAALRDSFLLTEDWWQTA 
22 9gamm-a0a265dzk1  47.5%  YKTIDQFTHSAVAKTTGGLAPS------VLGEAWLDWAVHMAASPGKQWQLMESAMRNAQALWLQSI-------PGN-EATCANNKPEDKRFASHGWQQYP-FNLWSQAHCQHWQWWQEA 
23 9burk-q4b3g8      45.9%  LPPMDVPLKLWLARQAHGISPA------SLTLAYTDWLSHLLVSPSKQAELGASALRKWLLWLQYAPQPW----QQD-RPVSVESPSQDKRFSRPEWQAPP-FNVLAQAFLQQQQWWAEA 
24 9burk-q3fd95      45.0%  AEQWNRAAHASVAAMTFGLSPV------SLALATLDWAAHLAVSPGKCFDLAMQACAAAVAPAADQCEAEAG-EADP-TGLAVHAGQADPRFAAPAWAGWP-FHVYRDSFLAIQRWWRDA 
25 burvg-a4jsh6      43.9%  AEQWNRAAHANVAALTLGLSPV------SMALAMLDWGAHLAVAPGKCFELAAQAWQAAVAPSSQVRDAAA---ADP-GGLAVHAGDADPRFAAPAWDAWP-FHVYRDNFLAIQRWWRDA 
26 ralme-q1lcz5      44.1%  DVAYDEQVRALLASMTGGVSFG------SLALAWTDWAMHLAASPGKRWRAALQ-------WQATAAAEYS---LAP-PFMPRPPVVTDQRFSAPGWENWP-YCVLRDGFLRLESLWMAL 
27 legpa-q5x2r4      44.6%  FPFFTRLVQANLAKWTAGISPA------AIGSSYSTWLWQLAQSPGVLWELAFYPVFHANDCVNNIIC------------VERAADGKDVRFKKDSWQPMP-WRLFAEGFLQMEDWWRRA 
28 legpa-q5x3j6      45.2%  FSFFTRLTQANLAKWTAGISPA------AIGSSYSTWLWQLAQSPGVLWELAFYPVLHAKDCINNIVC------------AERAADGKDVRFKKNSWQPMP-WRLFAEGFLQMEDWWRRA 
29 legph-q5zwi8      45.9%  FSFFHKLFQANLAKMTLGISPA------ALGSSYSTWLWQLAQSPEVLWELALYPFLHANDCINNIIC------------VERAADGKDVRFKKDSWQPMP-WRLLAEGFLQVEDWWRRA 
30 legpa-q5x322      43.7%  FRFIDKLYQANLGKLTAGISPA------ALGTAYYSWFAQLLQSPGSMLRLAYYPLLHANDYLSNLFK------------YDKPRDGKDVRFHTENWSYYP-WRLWAEQFLQFEDWCLQA 
31 rhofd-q21u70      42.1%  AQALDEAFHSQLAKVNLGLSPI------SLALAYADWAMHLATSPGQQMLLAQRALALSQQALSSPWQEQL---ASD--DASQPAPVDDPRFSDPGWRHWP-FNVLKESFKATSSWWHEA 
32 9gamm-q350p6      31.8%  ----------------RILDPW------GVTGAYAELGRRWLRQPDHVQSMALRCAANGAALTETFWRQAL---GLP-RQAVETPHPEDIRFSDPAWEGNALLNRMMQAYLVHTRWLMDA 
33 aroae-q5p0w7      31.8%  PQAVRRTLHEIHGHVEGTVDPL------GVAAPIVHAQLAWFAHPQEFAERVAGLSSELWRLQEHSWRRLM---GLA-NPDPVSPNADDERFADPVWTDVASWDLVKEWYLAVTHHMQDM 
34 decar-q47hd2      31.4%  VESLGKALG-------NAVDPY------GVTTSMLAAQMAWLMHPQELARAMSALSGDLVELQTHVMHRAM---GLP-SADVIRPNADDARFADPIWTESATWDIVKEWYIAFTHRLEDM 
35 hydte-a0a2z6dwt1  30.0%  PERMAEVLHHM---AEESWDPI------GMSAPLLHALFAWGAHPLEANALWWRAAEDSARWQQFVWQRVL---GEADAPPPFPPVADDTRWDHPAWQTHPFWAGWQQAYLGATRLMQDA 
36 rhoru-PHBCRR      30.1%  -------LDHVHKKLKSTLDPI------GWGPAVTSVAGRAVRNPQAVTAATAEYAGRLAKIPAAATRVFN---AND-PDAPMPVDPRDRRFSDTAWQENPAYFSLLQSYLATRAYVEEL 
37 9sphn-q2n9u1      25.8%  -------FDDEAAQHTTALGPLVGLTREDIFGAVAVLLRETASDPQRLMRHGQEMGSDMIKIMT--------------GQSELAPNPKDKRFMDPAWRYNPFMRAGMQYYLAVQKGMSSW 
38 rhoco-PHAC        26.2%  GESVEESIGGGEDVAPPRLGPAVG--------ALADVFGH----GRAVARHGVSFGRELAKIAV--------------GRSTVAPAKGDRRFADSAWSANPAYRRLGQTYLAATEAVDGV 
   consensus/100%           ...................s............s...h..t....s..........................................tD.Ra.t..W...s.h..h.p.ah...thh..h 
   consensus/90%            ....t..htt..t.ht.slsPh......sh..uh.sh..phh.tPtt.hthh.....t...h.....t..............h.s.stD.RFtt.tWt..P.aphh.p.aL..pphh.th 
   consensus/80%            ...hsc.hpu.hu.hstuluPh......uls.AhhcWhhphh.sPtp.hphs.tshtthhth.t..ht............s.hts.stD.RFtsstWp..P.aplhhpsaLhhppahppA 
   consensus/70%            .p.h-+hhcA.hAthTtGlSPs......ulshAhhDWhhHLshuPscphcLstpshppshphhphhhp............sshtP.spDpRFssstWpt.P.aplhtpuFLhhppWWppA 

 1 9brad-q35fu4     100.0%  TTGI-RGVDPANEAVVDFSLRQLLDMFAPSNFAATNPEVIEKTFQSGGENLVFGWQNWLADLMQVLH-----PGRPPG--NAEFVVGRTVATRPGKVVLRNRLMELIQYAPTTEKVRPEP 
 2 braja-bll6073     67.5%  TTGV-RGVSHANEAVVEFSVRQMLDMLAPSNFAATNPQVLEKAFQSGGENFVFGWQNWCSDLMRLLS-----VSKTAG--DEQFVVGKTVAATPGKVVYRNDLIELIQYHPTTAQVRPEP 
 3 rhop2-q2j0d2      58.1%  TTGI-RGVSRQNEKIVEFSVRQMLDVFAPSNFAGTNPEVIRRTLDSEGGNLAAGLGNWWEDLRQSMS-----HETDL---KQDFEVGRDVAVTPGKVVYSNDLIELIQYAPATAEVRPEP 
 4 rhopa-q37lc6      57.8%  TTGI-RGVSQQNAKIVEFAMRQMLDVFAPSNFALTNPEVIRRTLTSEGGNVTAGLRNWWEDLLQTMS-----HDTDL---KHDFEVGRDVAVTPGKVVYSNDLIELIQYAPATGEVRPEP 
 5 rhopa-q6n209      58.2%  TTNI-RGVSEQNEKIVEFATRQMLDVWAPSNFALTNPEVLRRTVSTEGRNLADGFRNWWEDLLELMA-----HEP-----KHDFVVGKDVAVTPGKVVYSNKLIELIQYAPATETVRPEP 
 6 rhopa-q374l7      60.8%  ATGV-RGVSRHNEAIVDFSMRQWLDAFAPSNFAASNPEVIRKTVESRGQNFVAGLQNWCSDWQRLLA-----GT--SA--AHPFVVGKDVAVTPGKVVYRNHLIELIQYAPATAEVHPEP 
 7 rhopb-q20z62      59.2%  TTGV-RGVSHQNEAIVAFSMRQLLDTFAPSNFAVSNPEVIQKAIATGCSNFAAGLQNWWSDLQALQS-----GK-PVA--DHRFTVGKDVAVTPGKVVYRNDLIELLQYAPSTPQVHPEP 
 8 9brad-q355g0      50.3%  TTDI-DGVDKHHERVVEFVTRQLLDVISPSNIPWLNPEVSAATIQQGGLNLVNGMQHFHEDWLRLVD-----GRPPVG--AEQFKVGVNVAVTPGKVVYRNRLIELIQYSPTTDDVYAES 
 9 hahch-q2spi5      50.1%  TTDI-PGVSPRNENIVSFCARQILDLMSPSNIPWLNPEVIKKTLETGGKNFLDGLENWREDAQRMLN-----GDPPVG--SENYKVGENLAVTPGKVIYRNRLIELIQYAPTTERTYKEP 
10 9gamm-q34zq5      49.9%  TTDI-RGVETHHEDVVNFLGRQILDIYSPSNYFWTNPELMETTAKEGGANLYRGLRNWWDDTARRIQ-----GEPPAG--MEKWKVGENLALTPGKVVYSNRLIELIQYEPATDRVHPEP 
11 ectha-q2cqy0      49.3%  TTGN-RGVTQHHEDVVNFLGRQVLDFYSPSNFLATNPEVLEETLSQGGANLVQGFANLLEDTERTIS-----DRPPVG--AEDWKVGENLAVTPGKVVYRNRIMELIQYQPTTKTVYPEP 
12 9gamm-a0a265du41  54.3%  TTGL-RGLSPHHEQALEFGARQWLDVLSPSNYVLTNPTVLEKTLTSGGTNLLRGMEHWWEDVQNQGL-----GRKPAG--TEDFVLGRDVAITPGKVVYRNHLIELIQYTPSTKDVHAMP 
13 silpo-q5lws0      49.7%  TTGV-RGVTRQHENVMEFATRQILDMFSPSNYLLTNPEVQERTLKEGGLNLLRGFQNWLDDLDRLQS-----GKPPAG--AKAFRPGQEVAVTPGKVVYRNHLIELIQYTPTTDTVRPEP 
14 aroae-q5p115      51.8%  TRGV-PGVSRHHENVVSFTARQSLDVFSPGNYLATNPLVLKRTTEQGGTNLWRGLVNALDDLERVAT-----GHPPAG--AEDFVVGRDVAVTPGKVVLKNRLIELIQYSPTTEKVHPEP 
15 burma-q62eb8      52.8%  TRDV-PGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLIT-----KQPPAG--AEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQP 
16 pardp-a1b9s7      44.4%  THDV-PGTDPHYENLLSAMVRQWLDMASPANLPFTNPEIIARSMQTAGLNHLAGMRNWCEDMARLAA-----GKPPVG--TERFRVGYEVAATPGKVVFRNHLIELIQYAPATETVLAEP 
17 pardp-a1bcb9      50.2%  THEV-PGMNPHHQEIVSFTARQILDVFSPSNLPFTNPEVIARTMETGGMNLVQGMRNWTEDMIRQAT-----GQPPVG--TEDFVVGKDVAVTPGKVVYRNHLIELIQYAPATRTVMAEP 
18 xanp2-a7igw0      49.5%  THGV-PGVKPHDEALVAFAARQLLDVFSPSNSPLTNPEVIRRTRETGGMNFVEGARNALADLARKAS-----DAPPVG--AEAFVPGQNVAVTPGEVVYRNHLIELIQYRATTSEVAAEP 
19 brasb-a5esl7      49.2%  TTGV-AGVTKHHEDMVAFTVRQWLDTVAPTNFLATNPVLQQRILDTGGRCLIDGVRNLMDDMGRMVR-----GQPPAG--AEAFRVGESVATASGKVVCRNRLMELIQYAPTTDMVRPEP 
20 acicj-a5g2y8      50.5%  ATGI-AGVDAAHERIVDFMIRQALDAVAPANLPMLNPEVEHAARESRGDSVRAGLRNLLKDTEIALN-----QE---N--RLPLAPGRDVAVTPGRVVYRNRLIELIQYSPVTETVRPEP 
21 rhos4-q3iye8      47.5%  TTGL-RGMDRAHEAALSFSVRQMLDVWSPSNNPFLNPEVLARTTETRGANLMQGAMNFAGDMARLAT-----GV-PMD--EGGFRIGETLAATPGKVVLRTHLMELIQYSPTTREVHPEP 
22 9gamm-a0a265dzk1  47.5%  MTGV-HGVAPSHEDLMAFVAGLLVDTSAPSNFPFTNPDVIAAMQAEQGQNFVRGAKNLANDLHQKAS-----PSEPAS--PQLFKVGQNLAITPGKVVFRNHLIELIQYTPSTERVRPEP 
23 9burk-q4b3g8      45.9%  MTGV-RGVSRHHEEVAAFITRQWLDMLSPSNFIATNPQVLKETLANGGVNLATGLANWSRDAVAVLT-----DGKPRG--VEAFAPGQGVALTPGKVVFRNHLIELIQYEPVTAEVDTEP 
24 9burk-q3fd95      45.0%  THGV-PGVERHHEELVGFAARQWLDACSPGNFLATNPVVLDATMSSGGANLAAGALNWLEDAKELLERAA--GTHAHD--ARTYLPGRDVAITPGRVVWRNALCELLQYEPTTARVASEP 
25 burvg-a4jsh6      43.9%  TSGV-PGVERHHEELVGFAARQWLDACSPGNFLATNPVVLDTTMRSGGANLATGLRHWADDARALFEHTG--EQRAHD--ARPYLPGRDVAVTPGRVVWRNALCELLQYDPTTTDVAREP 
26 ralme-q1lcz5      44.1%  TSDI-DGLSPHHQRIAAFCARQWLDMLSPSNVWWMNPTVLDATMQTRGANFVRGAGNLVEDLYDAVG---ERLHLPIGRLPHAYVVGRDVGITPGKVVYCNDLFELIQYSPTTDSVYRDP 
27 legpa-q5x2r4      44.6%  TTDV-PGLPNQVERTVSFWTRQSLDALSPSNFVWSNPDLFHEARRTGGLNLIQGSQIAFEDWLEKLT-----GAPPTG--SEHFIPGKQVAITPGRVVFQNHLIELIQYEAQTKTVYKEP 
28 legpa-q5x3j6      45.2%  TTDV-PGLPKPVERTVSFWARQCLDALSPSNFAWSNPDLFHEAMRTGGLNLIQGTQIALEDWLEKLA-----GAPPTG--SEHFIPGQHVAITPGRVVFQNHLIELIQYESHTKTVYKEP 
29 legph-q5zwi8      45.9%  -TNI-PGLPRQVERTVSFWVRQCLDSVSPSNFVWSNPDLFHEAIRTNGLNLLKGSQIAMEDWLEKLT-----GAPPTG--SENFIPGKDVAVTAGRVVFQNHLIELIQYEAQTKTVYKEP 
30 legpa-q5x322      43.7%  SSKV-PGIPLHVKRTVTFSTRQILDALSPSNFVLTNPDLLQETIRSNGQNLIRGTELAFQDFVEKIT-----GSPPAG--VENFIPGKQVAVTKGKVVYSNHLIELIQYTPQTEKVYKEP 
31 rhofd-q21u70      42.1%  SQ-V-EGVSSHHRHVVDFFNRQGLDALSPSNLPVTNPEAIKKGKESLGQSWLKGYQHLALDLLERSQHTGGASRTALK--PLPFKVGQDVAVTPGKVVFRNHLIELIQYTPTTAGVYPEP 
32 9gamm-q350p6      31.8%  LYET-PDMDPRALQRAAFWTRQWVDAVAPGNCFLSNPEALQRVIETGGESLGQGLQRFLSDL--LTG-----ELPMTD--REAFRVGGNIAETPGQVVYRNRLVEVIQYRPATDTVYATP 
33 aroae-q5p0w7      31.8%  LYDS-PGMSGKERRRAAFWWRQWINAVAPTNFYATNPVAMRKATQTCGASLLRGYGIFLGDL--RAG-----NVRMTD--PHDFDVGRNLATTPGAVVFRNDLLEIIHYAPTRAKVHAEP 
34 decar-q47hd2      31.4%  FFET-PGLSDKERRRSAFWLRNWLNMVAPTNFFLLNPVAMRRFVETNGESLKQGWENFQRDV--KAK-----NILMVE--PDAFKVGEDLATTPGKVIFRNRLVELIHYAPTTAKVRAMP 
35 hydte-a0a2z6dwt1  30.0%  LYAT-PGLSEKERRRAAFWHRTFANALAPTNFFWSNPEAQRRALATSGASLWQGMKNFWADV--AAG-----QVRMSR--TDDFRVGENLATTPGQVVARNALAEVIRYHPATPNQYARP 
36 rhoru-PHBCRR      30.1%  TEAG-SG-DPLQDGKARQFANLMFDALAPSNFLW-NPGVLTRAFETGGASLLRGARYAAHDILNRGG-----LPLKVD--SDAFTVGENLAATPGKVVFRNDLIELIQYAPQTEQVHAVP 
37 9sphn-q2n9u1      25.8%  LEDL--ELDELEKDRARFISNIIIDGLAPTNTLMGNPTAQKRLIDSGGLSLIKGLKNAYTDITENKG-----MVSQVD--KRPFKLGENVATSKGSVVLRTEMMELVHYAPTTDEVYEIP 
38 rhoco-PHAC        26.2%  VDEVGRAIGPRRTAEARFAADILTAALAPTNYLWTNPAALKEAFDTAGLSLARGTKHFVSDLIENRG-----MPSMVQ--RGAFTVGKDLAVTPGAVISRDEVAEVLQYTPTTETVRRRP 
   consensus/100%           ......t......t..t...t..hs..uPsN..h.NP.h.tt...p.s.shh.G...h..Dh.....................h..G.tlu.t.GtVl.psthhEllpYts.p......s 
   consensus/90%            h.th..Gh..t.pthhtF.hc.hlshhuPsNh.h.NP.h.tthhtptG.shhtGh..hhtDh...ht..........t...t.a..GpplAhTsGpVVhpNcLhEllpYtstTtpVh..P 
   consensus/80%            hpsl..Gls.ppcthstF.hRQhLDhhuPoNh.hsNPtlhpcshpotG.shhtGhtphhpDh.thht.....t...hs...ctFhsGpslAhTPG+VVapNcLhELIQYtPsTtpVh.cP 
   consensus/70%            opsl..Gls.pp-phlsFhsRQhLDshuPoNahhoNPplhccshposGtNLhpGhpphhpDh.phhs.....tt.sss..scsFhlGcslAsTPG+VVaRNcLlELIQYsPsTtpVhsEP 

 1 9brad-q35fu4     100.0%  VLVVPAWIMKYYILDLSAHNSLVRYLTDQGFTVFMISWRNPGAADRDLAFDDYRSLGVMSALDTIGRIVPNT-QVHATGYCLGGTLLSITAAAM------------------------AR 
 2 braja-bll6073     67.5%  ILIVPAWIMKYYILDLSPQNSLVRYLTGQGFTVFAISWRNPDAKDRDVAFDDYRKLGVMAALDMIGRIMPDR-KTHALGYCLGGTLLSIAAAAM------------------------AR 
 3 rhop2-q2j0d2      58.1%  ILIVPAWIMKYYILDLSPHNSLVRFLVAQGFTVFMISWRNPTAKDRDIALEDYRRLGVLAAIETVGAIVPDQ-PIHAVGYCLGGTLLSIAAAAM------------------------SR 
 4 rhopa-q37lc6      57.8%  ILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPTAKHRDLTLEDYRRLGVMAAIETIRAIVPHQ-PIHAVGYCLGGTLLSIAAAAM------------------------SR 
 5 rhopa-q6n209      58.2%  ILIVPAWIMKYYILDLSPHNSLVKYLTEQGYTVFMISWRNPTAADRDVSLEDYRRLGVMAALDTIGAILPDR-PVHAVGYCLGGTMLSIAAAAM------------------------GR 
 6 rhopa-q374l7      60.8%  ILIVPAWIMKYYILDLSPKNSLVKYLTDHGFTVFMISWRNPDAADRDIGFDDYRRLGVDAALAAIGDIVPDT-LVHAVGYCLGGTLLSIAAAAM------------------------AR 
 7 rhopb-q20z62      59.2%  ILIVPAWIMKYYILDLSPRNSLVKFLVDRGFTVFMISWRNPEARDRDISFDDYRKLGVDAAVVEITRLVPDA-GIHAVGYCLGGTLLAIAAAAM------------------------AR 
 8 9brad-q355g0      50.3%  VLIVPAWIMKYYILDLSPHNSLVRYLVERGHTVFMISWKNPAGSDRDLGMDDYRELGIVAALRAIDEICDHR-KTHAVGYCLGGTLLAIAAAAM------------------------TR 
 9 hahch-q2spi5      50.1%  VLIVPAWIMKYYILDLSPHNSLARYLVEQGHTVFMISWLNPDSKDRNLGMQDYLRLGVTEALDAISAIVPDAPAIHGVGYCLGGTLLSIAAAAM------------------------AR 
10 9gamm-q34zq5      49.9%  VLIVPAWIMKYYILDLRPGKSLVEYLVNQGHTVFMMSWKNPSADDSDLGMEDYRKMGIMDALKAVNTIVPEQ-KVHAAGYCLGGTLLMLAAAAM------------------------AR 
11 ectha-q2cqy0      49.3%  ILICPAWIMKYYILDLRPGKSLIEYLVSKGHTVFVISWKNPGSEDRDLGMDTYRREGVMDALEAVTTIVPER-KVHTVGYCLGGTLLMLAAATM------------------------AR 
12 9gamm-a0a265du41  54.3%  ILIVPAWIMKYYILDLSPHNSLVKYLVDQGHTVFMISWRNPTEEDRDLRMDDYHQQGILDSLNVIAQLIPDQ-KIHTVGYCLGGTLLAITASAL------------------------AR 
13 silpo-q5lws0      49.7%  ILIVPAWIMKYYILDLSPENSMVKFLVDQGYTVFMISWRNPSAEDRDLGLDDYRKMGVVDAIGAVQGIVPDQ-KIHGVGYCLGGTLLSISAATM------------------------GR 
14 aroae-q5p115      51.8%  VLIVPAWIMKYYILDLSPHNSLVKYLVDQGHTVFCISWKNPGAEESDLDMEDYVQSGFHAALTAVNAIVPDR-KVHAAGYCLGGTLLSIANAAM------------------------AR 
15 burma-q62eb8      52.8%  VLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGE-KIHATGYCLGGTLLSIAAAAM------------------------AN 
16 pardp-a1b9s7      44.4%  VLLIPAWIMKYYILDLSPENSLVRHLVQAGHTVFCLSWRNPTADDRDLTLDDYRRLGVMAAVEAINAILPGR-GIHAAGYCLGGTLLAIAAAAM------------------------AG 
17 pardp-a1bcb9      50.2%  ILIVPAWIMKYYILDLSPQNSLIRHLVAQGHTVFCISWRNPTAEDRDLTLDDYRRRGVMAALEAINAILPQR-KVHAVGYCLGGTLLSIAAADM------------------------AH 
18 xanp2-a7igw0      49.5%  VLIVPAWIMKYYILDLSPENSLVRHLVSKGHTVFCISWRNVTEEDRHLGFDDYRTQGVMAALDAIAAIVPGS-KVHAAGYCLGGTLLSVAAAAM------------------------AR 
19 brasb-a5esl7      49.2%  ILIVPAWIMKYYILDLSPGNSLVNWLTGQGFTVFMISWSNPGSADRDLDMEDYRRLGPMAALDAICAITGAA-SVHSVGYCLGGTLLSIVAATM------------------------AR 
20 acicj-a5g2y8      50.5%  VLIVPAWIMKYYILDLSPENSLVRYLVGQGYTVFMISWHNPDKEDRNLSLDDYRADGVMAALDAVSAITGAR-KIHATGYCLGGTLLSIAAAAM------------------------AR 
21 rhos4-q3iye8      47.5%  VLIVPAWIMKYYILDLSEQNSLVRWLVAQGFTVFMISWRNPESEDRDLGLIDYLDQGPRAALKAIQTITGAP-KVHAAGYCLGGTLLSIMAARM------------------------AH 
22 9gamm-a0a265dzk1  47.5%  ILIVPAWIMKYYILDLSPTNSLVQFLVGQGFTVFIVSWKNPSVEDRDLGMEEYRQLGVMEAIDAIQAITQAP-KLHAVGYCLGGTLLAIAAAAM------------------------AR 
23 9burk-q4b3g8      45.9%  VLIVPSWIMKYYILDLTPDDSLVKYMVAQGHTVFMISWRNPDSGDRDLGMDDYLELGVMAALQAVRSVRPRA-RIHAMGYCLGGTLLAIAAAAL------------------------AG 
24 9burk-q3fd95      45.0%  ILIVPSWIMKYYILDLQPHNSLIRFLVDAGYTVFAVSWRNPGAEARDFGLDDYLRDGCMAALDAARSVCGG--AVHAVGYCLGGTLLAIVAAAL------------------------AR 
25 burvg-a4jsh6      43.9%  ILIVPSWIMKYYILDLQPHNSLIRFLVDSGYTVFAVSWHNPGAEARGLGLDDYLRDGCMAALDAARSICGE--AVHAVGYCLGGTLLAIAAAAL------------------------AR 
26 ralme-q1lcz5      44.1%  VMIVPSWIMKYYILDLQPQNSMVKYLVDQGHTVFMLSWRNPGAEARDTSLDDYLKQGLLTALATVRERCGQE-QVHAVGYCLGGTLLAIAAAKL------------------------AR 
27 legpa-q5x2r4      44.6%  ILIIPAWIMKYYILDLSPHNSLVKWLVSQGHTVFIISWRNPDKEDRDLGMDDYYRQGAMAAIDTVSTLLPGT-KINLMGYCLGGTLAMITAAAM------------------------VR 
28 legpa-q5x3j6      45.2%  ILIFPAWIMKYYILDLSPHNSMVKWLVSQGHTVFIISWRNPDKEDRDLGMDDYYRQGAMAAIDTVSTLLPGT-KINLMGYCLGGTLAMITASAM------------------------GR 
29 legph-q5zwi8      45.9%  ILILPAWIMKYYILDLSPHNSLVKWLVKQGHTVFIISWRNPDKEDCDLGMDDYYRLGAMAAIDMVSTILPET-KINLMGYCLGGTLAMITASMM------------------------GR 
30 legpa-q5x322      43.7%  ILILPAWIMKYYILDLLPENSLVNWLVRQGHTVFIVSWRNPTKEDRNLGLDDYYKLGAMDAINAVSNAIPHT-KIHLMGYCLGGTLALLTAAAM------------------------AH 
31 rhofd-q21u70      42.1%  LLIVPSCIMKYYILDLSPGNSMVRYLVGQGHTVFMISWRNPDASDRELGMQDYLQLGVMEAMAAVKSLTGAP-RIHALGYCLGGTFLAIVAAALGARQPQSHRRGQGKNQHRRREDAVAL 
32 9gamm-q350p6      31.8%  LLFVPPWINRFYILDLNRRKSMVRWLVAQGYTVFLISWKNPGAEMRDLHFEDYLTEGLDPAVQAVREITRAP-ALHAAGYCIGGTLLSCYMAWSNRG--------------------PEG 
33 aroae-q5p0w7      31.8%  VVIVTPWINKFYILDLAPRKSMIRFLLDQGLDVFITSWKNPDAGMHDVGFDGYLQDGVHAVVETARRFTGAA-RVHAVGYCIGGTALSMYMAWANRR---------------------FP 
34 decar-q47hd2      31.4%  IVIITPWINKFYILDLTAKKSMVKYLTDQGFSVFITSWKNPGEELSDVRFDDYLLEGVNEVVSVASEFCKVP-KVHLVGYCIGGTLVSTYMAWANKR---------------------FG 
35 hydte-a0a2z6dwt1  30.0%  LVIVPPWINKFYILDLTPQKSLVRFLRDAGFDLFIISWRNPTAEMAATTFEEYLRLGIDCAVETARTLSGSD-KVQAVGYCLGGTALASYAAAKGA----------------------EQ 
36 rhoru-PHBCRR      30.1%  ILAAPPWINKYYILDLAPGRSLAEWAVQHGRTVFMISYRNPDESMRHITMDDYYVDGIATALDVVEEITGSP-KIEVLSICLGGAMAAMAAARA------------------------FA 
37 9sphn-q2n9u1      25.8%  QLTIPPQINKMYINDLSPEKSVVKYQLDNGIQTFVISWRNPSKEQGVWDMADYVA-SCREAMEAVSAITGSK-KVNVSAGCSGGQTAAMLASKM------------------------AS 
38 rhoco-PHAC        26.2%  VLVVPPPIGRYYFLDLRPGRSFVEYSVGRGLQTFLLSWRNPTAEQGDWDFDTYAG-RVIRAIDEVREITGSD-DVNLIGFCAGGIIATTVLNHL------------------------AA 
   consensus/100%           .hhhss.I.+hYh.DL..tpShhpa.httGhphFhhSa.Nst.t.t.hth.tYh..t...sh..htth......hp..uhC.GG.hh....s............................ 
   consensus/90%            llllPsWI.KaYILDLpstpShlcahstpGhsVFhlSW+NPstt.pshshp-Yht.Gh.tAlthhtthhst...lphhGYClGGThh.hhhuhh.........................t 
   consensus/80%            lLIlPuWIMKYYILDLsPppShl+aLstpGaTVFhlSW+NPstpt+clsh-DYhp.GhhsAlpslttlhst..tlHshGYCLGGTLlulsAAth........................ut 
   consensus/70%            lLIVPuWIMKYYILDLoPpNSLV+aLVspGaTVFhISW+NPsuc-RDlsh-DYhp.GlhsAlcslpslssst.plHusGYCLGGTLLuIsAAsh........................u+ 

 1 9brad-q35fu4     100.0%  DG--DDRLKTITLFAAQTDFTEAG-ELTLFINESQVAFLEDMMWERGYLDTTQMAGAFQLLRSNDLIWSRVSRDYLLGERASPSDLMAWNADATRLPYRMHSEYLRRLFLNNDLAE-GRY 
 2 braja-bll6073     67.5%  DG--DGRLGTITLLAGQTDFTEAG-ELTLFINESQVAFLEDMMWQRGYLDTTQMAGAFQLLRSNELIWSRLSRDYLMGESSQPSDLMAWNADATRLPYRMHSEYLRKLFLDNDLAE-GRY 
 3 rhop2-q2j0d2      58.1%  DG--DTRLKSITLFAAQTDFTEAG-ELTLFINESQVAFLEDVMWKHGVLDASQMAGAFQMLRSNDLVWSRMVRDYLMGERSEPNDLMAWNADATRMPYRMHSEYLRKLFLDDDLAE-GRY 
 4 rhopa-q37lc6      57.8%  DG--DDRLRSITLFAAQTDFTEAG-ELTLFINESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWNADATRMPYRMHSEYLRKLFLDNDLAE-GRY 
 5 rhopa-q6n209      58.2%  DG--DSRLKSITLFAAQTDFTEAG-ELTLFINESQVAFLEDMMWNRGVLDTTQMSGAFQILRSNDLIWSRLVHEYLMGVRSEPNDLMAWNADATRMPYRMHSEYLRKLFLDNDLAE-GRY 
 6 rhopa-q374l7      60.8%  EG--IHRLNSITLLAAQTDFTEAG-ELTLFINASQVAFLEDMMWQSGVLDTTQMAGAFQILRSNDLVWSRLVHDYLMGERDAPSDLMSWNADATRLPFRMHSEYLRQLFLDNDLAG-GRF 
 7 rhopb-q20z62      59.2%  DG--VSRLTSITLLAAQTDFTEAG-ELTLFINESQVAFLEDMMWDRGVLDTTQMAGAFQILRSNDLIWSRLVHDYLIGERAPPSDLMAWNADATRLPYRMHSEYLRKLFLNNDLAG-GRY 
 8 9brad-q355g0      50.3%  SG--INQLASITLLATLVDFTDPG-ELGLFISESEVAFLEGITWEQGYLDTHQMAGAFHLLRSNDLIWSRALRSYLLGVRPPMNDLMAWNADATRLPYRMHSEYLRHLYLDNDLVS-GRY 
 9 hahch-q2spi5      50.1%  NE--DKRLATISLFAAQTDFKEAG-ELMLFINESQLTFLEDLMWEQGYLDATQMSGAFMMLRSKDLLWSRIVREYMLGERSSMNDLMAWNADTTRMPYRMHSQYLRSLFLNNDLAE-GRF 
10 9gamm-q34zq5      49.9%  EG--DDRLASLTCFAAQCDFTEPG-ELDLFIDDSQVTFLEDMMWHAGYLSSDQMAGAFQLLRSKDLIWSRMVREYLMGERSEMIDLMAWNADTTRLPYRMHSEYLRQLFLNNDFVE-ERY 
11 ectha-q2cqy0      49.3%  DG--DDRLASLSLLAAQADFTEPG-ELELFIDESQVTFLEDMMWEKGYLDGAKMAGAFQLLRSKDLIYSRLIHDYLMGKRAPVIDLMAWNADTTRLPFRMHSEYLRDLFLNNDFVE-DRY 
12 9gamm-a0a265du41  54.3%  DK--DDRLASMTLLAAQTDFREAG-ELMLFIDEKQLAFLEDLMWAQGILDTKQMAGAFQILRSNDLIWSRIVNEYLLATRQPMNDLLAWNTDATRMPYRMHSEYLRQLFLNNDFAE-GRF 
13 silpo-q5lws0      49.7%  DG--GDPFASLSYLASQIDFTEPG-ELQLFINESQLTFLEDMMWDHGYLDTTQMSGAFQMIGSADLVWSRSLHSYLMGDEPAMFDLLAWNADGTRMPYRMHSEYLRSLYLNNELTE-GAF 
14 aroae-q5p115      51.8%  DG--DERLASMTLFAAQTDFTEPG-ELALFIDESQVSLLEAQMAETGYLTAGQMAGAFQLLRSYDLLWSRMVGEYLMGERAPMNDLMAWNADATRMPARMHTQYLRLLFLNDDLSE-GRY 
15 burma-q62eb8      52.8%  TG--DDRLASITLLAAQTDFAEPG-ELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLAT-NRY 
16 pardp-a1b9s7      44.4%  AR--DDRLASVSLLAAQTDFTEPG-DLALFVDHDQLHSLENAMRQRGYLTAEQMLGAFRFLRSNDLVWSRMVHAYLMGEREPMTDILAWSSDSTRMPYRMQDEYLRRLYLENALAG-DRL 
17 pardp-a1bcb9      50.2%  GD--DDRLASLTLLAAQTDFSEPG-ELALFIDHSQVNLLESMMWNRGYLSADQMAGAFQLLRSNDLIWSRMVHDYLMGERRPMIDLMAWNADSTRMPYRMHAEYLERLYLDNELAA-GRF 
18 xanp2-a7igw0      49.5%  AN--DARLASVTLLAAQTDFSEAG-ELQLFVDPSELYTLESMMWDQGYLAAGQMAGAFEMLRSNDLVWSRLVHEYLMGERAPMNDLMAWNADATRMPYRMHSDYLRRFFLDNDLAA-GRY 
19 brasb-a5esl7      49.2%  DG--DERLASVTLLAAQTEFCEPG-ELGLFIDQGQLNLLESLMWSRGYFDSSQMGGAFQILRSNDLVWSRLLTTYLMGEREPMTDLMAWNADGTRMPSAMHSQYLRQLFLGDDLSE-GRY 
20 acicj-a5g2y8      50.5%  DH--DSRLASVTLFAAQTDFTEAG-ELQLFITEAQLAFLEDLMWQQGYLDTKQMAGAFQMLRSNDLIWSRMIRRYFIGEQEHPNDLMSWNMDATRMPYRMHAEYLRHLFLHNDLAE-GRL 
21 rhos4-q3iye8      47.5%  DH--DERLASMTLFAAQVDFSEAG-ELALFISEAQVALLEDMMWHQGYLDSDQMSGAFTLLRSNDLIWSRMIHEYMMGERPHPNDLMTWNADSTRMPYRMHSEYLRHLFLENRFAE-GKF 
22 9gamm-a0a265dzk1  47.5%  DG--DDRCATVSLLAAQIDFTEAG-PLRLFINDSQVTMIEDMMSQTGYLSSDQMAGAFALLRAKDLIWAPAIDRYLLGVQGHSFDLMTWNADATRMPYRMHSEYLRRLFLNNDLAD-GRY 
23 9burk-q4b3g8      45.9%  SS--PNLLKTVTLLAAQADFHEPG-ELGLFIDESQIAFVEDLMAEWGYLDERQMAGAFALINSKDLVWSKLVHEYLMGAHTPMTALRAWNADATRLPARMHSEYLRSLYLHNDLAA-GRY 
24 9burk-q3fd95      45.0%  DGRQHEALRSITLLAAQTDFSEPG-ELGLFIDASELSALDALMWRQGYLDGAQMSAAFQLLNARDLIWSRMMSEYLLGTRTKPNDLMSWNADTTRMPYRMHSEYLTRLFLDNDLAV-GRY 
25 burvg-a4jsh6      43.9%  DGRQHEALRSVSLLAAQTDFSEPG-ELGLFIDASELSALDALMWRQGYLDGAQMAATFQLLNARDLIWSRMMSEYLLGTRTKPNDLMSWNADTTRMPYRMHTEYLTRLFLDNDLAA-GRY 
26 ralme-q1lcz5      44.1%  DK--DDSLRSVTLFATETDFDEPG-ELGLFIDDSALSTLDALMRKQGYLDGFQMAQAFSMLRARDLVWSRVLREYLLGERDRPNDLMSWNRDTTRLPYRMHSEVLSRLFLRNELAE-GRF 
27 legpa-q5x2r4      44.6%  DK--DERLNSLTLLAAQGDFTEAG-ELMLFVTESQVDFLKSMMREQGYLDTKQMAGSFQMLRAYDLIWSKMVQDYMHGMRRGMIDLTAWNADATRMPYKMHSEYLEKLFLRNDFAE-GRY 
28 legpa-q5x3j6      45.2%  DK--DERLNSLTLLAAQGDFTEAG-ELMLFVTESQVDFLKSMMREQGYLDTKQMAGSFQMLRAYDLIWSKMVQDYMHGMRRGMIDLTAWNADATRMPYKMHSEYLEKLFLRNDFAE-GRY 
29 legph-q5zwi8      45.9%  YE--DERLNCLTLLAAQGDFSEAG-ELMLFVNESQVDFLKSMMWEQGYLDTKQMAGSFQMLRAYDLIWSKMVQDYMHGMRRGMIDLTAWNADATRMPYKMHSEYLEKLFLNNDFAE-GRY 
30 legpa-q5x322      43.7%  DH--DNRLKTLSLLAAQGDFIDAG-ELLLFITKSEVSFLKSMMWEQGYLDTKQMSGTFQMLRSYDLIWSKMVQDYMHGTQRGMIPLLAWNADATRMPYKMHSEYLEKLFLNNDFAE-GRF 
31 rhofd-q21u70      42.1%  DT--MPELASVTLLAAQTDFSEPG-ELGVFIDDDQLKTLRESMARTGYLSGRQMAGSFQFLNSRDLVWSRNTRRYLLGQDEVGNDMMSWNADVTRLPERMHNEYLSSLFLNNALAT-GNY 
32 9gamm-q350p6      31.8%  AA--GNPIAHWTTFTTLVDFEDPG-EIGAFISEESLEALDRLMDGHGYLPGEALAFSFRMLRPNTLIWQYYINNYLHGRDPAPFDVLYWNTDNTRLPKAMHSWYLRQCYLHNRLREPDGV 
33 aroae-q5p0w7      31.8%  PE--DVPVADWTLLATLVDFRKPG-DIEVFIDEGSIRYLTASMARKGFLDGKEMASAFRLLRSNSLIWHYVVHGWLYGEAPPPFDVLYWNMDTTRMPCAMHSWYLRELYLHNRLIEPNAL 
34 decar-q47hd2      31.4%  QD--KVPVAHWTLFTTLTDFAHPG-DIDVFIDEACIGALEESMAKKGYLDGSEMASSFRMLRSNPLIWHYWTQSYLLGEPLAPFDVLFWNMDTTRMPQAMHSYYLRELYLENNLIKRDKL 
35 hydte-a0a2z6dwt1  30.0%  GS--ETPLASATFFTTLVDFSAPG-DIEVFVDPGTVRYLCHKMRLTGYLDGAEMAAAFRLLRANSLIWHYVVHGWLYGEEPSPFDVLYWNMDTTRMPAAMHCWYLRELYLKNRLVRPGAL 
36 rhoru-PHBCRR      30.1%  VG--DKRVSAFTMLNTLLDYSQVG-ELGLLTDPATLDLVEFRMRQQGFLSGKEMAGSFDMIRAKDLVFNYWVSRWMKGEKPAAFDILAWNEDSTSMPAEMHSHYLRSLYGRNELAE-GLY 
37 9sphn-q2n9u1      25.8%  DK--DDLLGALTLMVCVLHPKQNDIEAGSLISKNGLELARQRAAKKGVIKGDDLARGFAWLRPNDLIWNYVINNYLLGDDPPAFDVLFWNADATNLSASLMGDFLTIFETLAFTKK-GEV 
38 rhoco-PHAC        26.2%  QG--DTRVHSMAYAVTMLDFGDPA-LLGAFARPGLIRFAKGRSRRKGIISARDMGSAFTWMRPNDLVFNYVVNNYLMGRTPPAFDILAWNDDGTNLPGALHGQFL-DIFRDNVLVEPGRL 
   consensus/100%           .t.....htthshhss.hc..tss..h..hhp.t.l..hp......Ghh.t.th..sF.hh.s..Llat...ttahhu......shh.Ws.DsTphs.th.s.hL..h.h.s.h...t.h 
   consensus/90%            tt...t.ltshohhss.hDFtcsG.-l.lFls.splthlct.MhppGhLsstpMuuuFthlpu.sLlWphhhppYhhG.p....Dlh.WNhDsTRhPhtMHs.YLpplaLpsthht.sth 
   consensus/80%            st..cptLtohoLhAs.sDFs-sG.ELtLFlspuplthLcshMhppGhLssppMuuuFphLRupDLlWuhhlppYhhGpc....DlhuWNsDsTRhPhcMHopYLcpLaLpNchst.G+h 
   consensus/70%            st..DscLsolTLhAAQsDFsEsG.ELtLFIscuplshL-shMhppGYLcspQMAGAFphLRupDLlWS+hlpcYLhGpcss..DLhuWNADuTRhPa+MHSEYLRpLFLpN-Luc.GRa 

 1 9brad-q35fu4     100.0%  RVEGKPVSLSDIHKPMFVVGTLRDHVAPWKSTYKIHY--EVDA-DVTFVLASGGHNAGIVAPP----DEQG--HSHQVRTKAADAPY-LGPDEWLSIAPRVEGSWWPTWIEWLKQQSGT- 
 2 braja-bll6073     67.5%  RVEGRSVSLSDIHAPMFVVGTLADHVAPWRSVYKIHY--QADA-DVTFLLTNGGHNAGVVAPP----DEPW--HTYQVMTKAADAPY-VGPDEWLKLAPRVEGSWWPEWAQWLAARSGE- 
 3 rhop2-q2j0d2      58.1%  VVDGRAIALSDIHTPMFVVGTLRDHVAPWRSAFKIHL--LADA-EITFCLTGGGHNAGIVSPP----SPKA--RGYQVMTKQADGPY-VGPDHWIEQAPHAEGSWWTEWVQWLGARSGE- 
 4 rhopa-q37lc6      57.8%  TVDDRAIALSDIHTPMFVVGTLRDHVAPWRSTFKIHL--LADA-EITFCLTGGGHNAGIVSPP----SPKA--HGYQVMMKEADGPY-IGPDDWIKEAPHAEGSWWTEWVHWLEARSGQ- 
 5 rhopa-q6n209      58.2%  VVDGRPIALSDIHTPIFVVGTQRDHVAPWRSTFKIHL--LADA-DVTFCLTGGGHNAGIVSPP----SPKA--HGYQVMTKEADGPY-VGPDDWLKQAPHAEGSWWTEWVHWLGTRSGE- 
 6 rhopa-q374l7      60.8%  LVEGRPISLTDIHTPMFVVGTLRDHVAPWRSTYKIHF--LADA-EITYLLASGGHNAGIVSPP----GEDQ--RHYQVLTKGADARY-IGPDDWLIAAPRHQGSWWPEWLRWLQARSGD- 
 7 rhopb-q20z62      59.2%  AVDGRPVSLSDIHTPMFVVGTLRDHVAPWKSTHKIHF--LADA-EITYLLTSGGHNVGIVAPP----GDSG--RSYQVLTKAADAPY-IGPDDWLKVAPHVEGSWWNEFARWLAARSGE- 
 8 9brad-q355g0      50.3%  KVGGRTIFLTDILVPIFAVGTEKDHVAPWRSVFKLHH--LTDT-DVTFVLTTGGHNAGIVSEP----GHKN--RSFQMATKNSADRD-TDPETWRTTAPRFEGSWWPVWQSWLARHSTG- 
 9 hahch-q2spi5      50.1%  EVDDSPIFLRDIRIPIFAVGATKDHVAPWKSVYKIRR--LTSSAEITFLLTSGGHNAGIISEP----GHPR--RSYQINTRYGQDRN-YSPDDWLNIAPRHEGSWWPAWSQWLRDHSSAE 
10 9gamm-q34zq5      49.9%  DVDGQPIHLWDVRTPIFAVGTTKDHIAPWKSVYKINR--LART-DVTFALTTGGHNAGIVTPP----GHPR--RTYQVHCRKVQDPY-LAPDDFLAEVPSKQGSWWPEWHRWLARHSGN- 
11 ectha-q2cqy0      49.3%  DVGGQPIHIGDIQVPTFAVGTEKDHIAPWRSVYKINR-FLPRA-DVTFALTQGGHNAGIVTPP----GHPR--RIYRSLARRYGDPY-VPSHVFLEKATEQQGSWWPEWEQWLRERSGS- 
12 9gamm-a0a265du41  54.3%  RVDDRPVTFNDIQIPVFCVGTEWDHVAPWRSTYKLHL--LSDAPEVTFLLTNGGHNAGIVSPP----EHPS--RHYRMATALDGDPY-IDPDSWFEHTPIQEGSWWPAWQEWLMERSGP- 
13 silpo-q5lws0      49.7%  VVEGRPISVTDIRVPVFSVGTVKDHVAPWPSVYKMHL--YLDT-DLTFVLTSGGHNAGIVSEP----GHRN--RSYQIATARHGDRY-VDPETWAAQTPKKDGSWWLEWMSWLGERSGK- 
14 aroae-q5p115      51.8%  PVGGKPVALSDIDTPIFCVGTVTDHVAPWRSVYKLHY--LTPA-EITFVLTSGGHNAGIISEP----GRAR--RHFQILERREGGNY-VSPDHWLAVAPEHEGSWWPEWVAWLKARSAA- 
15 burma-q62eb8      52.8%  VIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHY--LSGS-DVTFVLTAGGHNAGIVSEP----GHAK--RHYRMKMTAAAAPS-ISPDEWLAGATDFEGSWWPAWHAWLARHSSPQ 
16 pardp-a1b9s7      44.4%  RADGRPVALRNLRAPIFAVGTEEDYVAPWRSVYQLHC--LSDA-ELTFVLADKDHLAGIIFDP----SQPG--SHYRIATRGPDDTC-LPPEDWLRAAAWREGSWWPAWSGWLARHSAAE 
17 pardp-a1bcb9      50.2%  MVEGRPAAIQNIRVPMFVVGTERDHVAPWRSVFKIHY--LSNT-ELTFVLTSGGHNAGIVSEP----GRPH--RRYRIALREAGGRC-PGPDIWAETAEARPGSWWDAWTKWLAAHSSAK 
18 xanp2-a7igw0      49.5%  RVDGRPVSLLDIKVPLFVVGTERDHVAPWRSVFKIHQ--LTDT-DVTFVLTSGGHNAGIVSEP----GHKH--RHFRLHETRHGNMH-LGPDEWVEATKPQDGSWWLAWDDWLAARSTG- 
19 brasb-a5esl7      49.2%  KVDGRTISLSAMRQPMFVVGTERDHVAPWRSVHKIHR--LTGA-AIDFVLTSGGHNAGIVSEP----GRPR--RSYRLLRREADGPA-LDPDEWLTRTQLFEGSWWPAWSDWLKRHSGE- 
20 acicj-a5g2y8      50.5%  SAGGRPVAIGDIDVPFFVVGTERDHIAPWHSVYKLHL--LNRG-PITFVLTSGGHNAGIVSEP----GHPH--RHYAILDRSPGEPY-LAPEAWQDEAPKHDGSWWPEWVAFLGARSGP- 
21 rhos4-q3iye8      47.5%  ELEGHALSLTELRLPILAVGTETDHVAPWRSVFKIQR--LTET-ETTFVLTSGGHNAGIVSEP----GHPR--RHFRIATTGRDDPY-RDADEWFAETAPVEGSWWPAWGAWLAERSTP- 
22 9gamm-a0a265dzk1  47.5%  QVGNKAIAVTDIRAPIFAVGTEDDHVAPWRSVYKLHL--FVDV-DVTFVLTSGGHNAGIVSEP----GHQH--RHFRIANTPADAYY-RSPADWCAETTSQEGSWWPGFTNWLAQHSSD- 
23 9burk-q4b3g8      45.9%  RAAGQVVRLSHIELPLFVVATESDHVSPWHSVYKIHR--LTSS-PVSFVLSSGGHNVGIVNPPAGPAAHPQ--ASYRIASHAPGKAP-AHPGDWLDTAARREGSWWPGWHDWLNKHSSG- 
24 9burk-q3fd95      45.0%  CVDGRPVALSDIDVPTFVVGTERDHVSPWGSVYKLHL--LTHH-ALTFVLTSGGHNAGIVSEP----GHPG--RHYRRATRKPGAPY-RSRHDFVRETAAVDGSWWTCWRDWLHERSSG- 
25 burvg-a4jsh6      43.9%  CVDGRPVALSDLDVPTFVVGTERDHVSPWRSVYKLHL--MTHH-ALTFVLTSGGHNAGIVSEP----GHPG--RHYRCATREHGAPY-RSGHDFVRDTPPVEGSWWTCWSGWLRTHSSG- 
26 ralme-q1lcz5      44.1%  CVDGHPVAMADVEAPMFVVGTEHDHVAPWKSAYKLHL--LTHN-ALTFVLTSGGHNAGVVSEP----GHKG--RRYRVATRVPNGEY-KDPDRYAEEATRHDGSWWPCWHEWLAEQSSG- 
27 legpa-q5x2r4      44.6%  TVEGKPVAAENIELPVFAVSTEKDHVAPWQSVYKIHL--MTEG-DVTFVLTGGGHNAGIISEP----GHPG--RSYRVHEHKQGEAY-LNPGSWLAMAEKREGSWWQAWHEWLVQQNTKK 
28 legpa-q5x3j6      45.2%  TVEGKPVAAENIERPVFAVSTEKDHVAPWQSVYKIHL--MVKG-DVTFVLTDGGHNAGIISEP----GHLG--RSYHVHEHTQGETY-LNPESWLAMANVREGSWWQEWHEWLVRQNSKK 
29 legph-q5zwi8      45.9%  MVEGKSVAAENIQCPIFAVSTKKDHVAPWQSVYKIHL--MTEE-NVTFVLTGGGHNAGIISEP----GHSG--HAYHVHERKKGDAY-LNPTNWLEIAEKREGSWWREWHDWLVQQSTKK 
30 legpa-q5x322      43.7%  ILDGKPVVGENIRIPAFVVSTEKDHVAPWKSVYKTHL--LINS-DITFVLTNGGHNAGIVSEP----GHEG--RYYRIRERKMDSTY-LDPTNWLKKAELREGSWWIAWHDWLVNHSSQK 
31 rhofd-q21u70      42.1%  RVAGVGVALMDIRAPLLVVGTQRDHVSPWQSVYKIHL--LTDT-QTTFILAAGGHNAGIVSEP----GHRG--RSYQMDCMEKGHAW-TEPDDWAAHAPLFEGSWWEAMHRWLQERSGK- 
32 9gamm-q350p6      31.8%  VLAGRPIDLGRIDQPLYCVATVDDHIAPWRQVFRLPG--RVRG-ATRGVLSTSGHIFGIVNPPV---DPPK--RSYWAGDATGVT----DPDAWKADQAKTPGSWWEDWHAWLSARSGD- 
33 aroae-q5p0w7      31.8%  TVAGEPIDLACITQPLYAVATEDDHIAPWHEAYRVNN--FVTG-PKRYVLSSSGHILGIVNPPV---TPPK--RKYRVADAHRSD----AAEAWHAKAVEEVGSWWTDWMNWLTPRCGE- 
34 decar-q47hd2      31.4%  NIAGEAIDLDLIEQPLYAVTAEDDHIAPWKQCYRIRKQINVKA-PVRFVLSTSGHILGIVNPPV---NPPK--RAYWIGEPERNE----HWEHWFDRAEKKPGTWWEDWTRWLGERTGD- 
35 hydte-a0a2z6dwt1  30.0%  QLMGQPIDLRAITVPVYAVGAEDDHIAPWRQTYQLLK--HVRG-PKRYVLSSSGHILGIVNPPK---DPPK--RHYRVSDFAMLVP---KAEEWFAATDPQPNSWWSDWVLWLQREAGE- 
36 rhoru-PHBCRR      30.1%  VLDGQPLNLHDIACDTYVVGAINDHIVPWTSSYQAVN--LLGG-DVRYVLTNGGHVAGAVNPP----GKRVWFKAVGAPDAESGTPLPADPQVWDEAATRYEHSWWEDWTAWSNKRAGE- 
37 9sphn-q2n9u1      25.8%  EMVDHKIDLSKVKSDLFILGGVTDHITPWKATYRSTQ-LFGSK-DVTYVLSHSGHMQAILNPP----GNPK--ARYYLNKGKKLP---ETADEWQAGAEEVAGSWWPYWMEWVQKRSGE- 
38 rhoco-PHAC        26.2%  AVLGTPVDLKSITVPTFVSGAIADHLTAWRNCYRTTQ--LLGG-ETEFALSFSGHIASLVNPP----GNPK--AHYWTG----GTPG-PDPDAWLENAERQQGSWWQAWADWVLARGGE- 
   consensus/100%           .h.s..h.h..h..shh..ss..DalssW.tsap...........hphhLs.tsH..uhl..P....t.....t.h...............t.a........toWW..h..a...pss.. 
   consensus/90%            .htspslthtplp.PhasVus.pDHluPWppsa+hp...h.tt..hpahLssuGH.hGlls.P....s..t..pta.h..h..tt....tsptaht.s....GSWW.tW.tWL.tpss.. 
   consensus/80%            .ltGpslsltsIphPhFsVuT.pDHlAPW+Ssa+lph..hsps.tloFlLosGGHsAGIVs.P....up.t..+tYphhptt.ss...hsscpWht.s..hpGSWW.tW.tWLtt+Sut. 
   consensus/70%            tVsG+slslpsIchPhFsVGT.cDHVAPW+SsYKlHh..hscs.plTFlLTsGGHNAGIVu.P....uc.t..RpYpltppttss.h.hsP-pWhttAsth-GSWWstWtpWLtt+Sut. 

 1 9brad-q35fu4     100.0%  LREP--PQLGTE--GASDLPDAPGDYVHT---- 
 2 braja-bll6073     67.5%  PCDP--PSIGVG--GADGLPDAPGDYVHS---- 
 3 rhop2-q2j0d2      58.1%  PVPP--PRTGLPGVNPDELPDAPGRYVLQA--- 
 4 rhopa-q37lc6      57.8%  PVPP--PRIGLPDTNAAELPDAPGHYVLQA--- 
 5 rhopa-q6n209      58.2%  PVAP--PRIGLPDVDPGALPNAPGSYVLQT--- 
 6 rhopa-q374l7      60.8%  NRAP--PPLGHR--GDTELRDAPGSYVLQR--- 
 7 rhopb-q20z62      59.2%  MVDP--PAIGGRGADNMALADAPGSYVMQP--- 
 8 9brad-q355g0      50.3%  RIAP--PPLGNPATGLAPIADAPGTYVLER--- 
 9 hahch-q2spi5      50.1%  QSSP--PPLGAPDSGYPQLCDAPGTYIYQR--- 
10 9gamm-q34zq5      49.9%  KGKP--PQMGADVRGYRPQRNAPGKYVLMD--- 
11 ectha-q2cqy0      49.3%  RVAP--PSLGQSEGTYQPLTEAPGTYVLQS--- 
12 9gamm-a0a265du41  54.3%  LVPA--PDTGTK--AYPPLEDAPGSYVRQI--- 
13 silpo-q5lws0      49.7%  PVPP--PAMGN------ALTDAPGTYVHQK--- 
14 aroae-q5p115      51.8%  PVAP--PALGAPQSGYPALDDAPGQYVREK--- 
15 burma-q62eb8      52.8%  RVAP--PPLGKP--GAHTLGDAPGTYVFQK--- 
16 pardp-a1b9s7      44.4%  RVAP--PGIGAAAAGYPALEDAPGSYVRQR--- 
17 pardp-a1bcb9      50.2%  RTPP--PAMGARKAGHAPLADAPGTYVLQR--- 
18 xanp2-a7igw0      49.5%  PVGL--PKIGGP--GYPALGPAPGTYVMQR--- 
19 brasb-a5esl7      49.2%  AATA--PPMGAPDKNYPIIADAPGHYVLER--- 
20 acicj-a5g2y8      50.5%  PAAP--PPLGREEAGYPVLGAAPGHYIHER--- 
21 rhos4-q3iye8      47.5%  KGKL--PPMGNARSGYPALCEAPGTYILQR--- 
22 9gamm-a0a265dzk1  47.5%  PTTP--PHMGTRSGQYAVLCDAPGTYVKQT--- 
23 9burk-q4b3g8      45.9%  KVKP--PRVNAVMFEGAPL-AAPGRYVHLD--- 
24 9burk-q3fd95      45.0%  DVPARAPAAG--------LGAAPGTYVLQT--- 
25 burvg-a4jsh6      43.9%  DVPARVPAAG--------FAAAPGAYVLET--- 
26 ralme-q1lcz5      44.1%  RCAPRDPAPG-------SLRDAPGEYVMQG--- 
27 legpa-q5x2r4      44.6%  RIAS--SVMNP------SLPAAPGTYVLQK--- 
28 legpa-q5x3j6      45.2%  LIPP--PGLYP------N--------------- 
29 legph-q5zwi8      45.9%  RILP--PVLNT------SLPSAPGTYVLQK--- 
30 legpa-q5x322      43.7%  QVSA--PKLDK------NLPNAPGKYVLQK--- 
31 rhofd-q21u70      42.1%  PVPP--PAINPA----TVLGDAPGDYVMARYAD 
32 9gamm-q350p6      31.8%  RVAP--PSMGN--AGYPPLADAPGHYVLES--- 
33 aroae-q5p0w7      31.8%  LVEA--RAAAS--EAYPRLEDAPGSYVLEH--- 
34 decar-q47hd2      31.4%  LVDA--HPAAN--RKFPALADAPGTYVLEK--- 
35 hydte-a0a2z6dwt1  30.0%  RKTAADP------ETWPNLGAAPGRYVHE---- 
36 rhoru-PHBCRR      30.1%  LVAP--PAMGS--TAHPPLEDAPGTYVFS---- 
37 9sphn-q2n9u1      25.8%  KKDAP-KEVGN--SDYKALDPAPGLYVVEKV-- 
38 rhoco-PHAC        26.2%  ETAA--PDAPGS-AHDRALDAAPGRYVRDLPAG 
   consensus/100%           ................................. 
   consensus/90%            .h.s..s.hs........l.sAPGpYlht.... 
   consensus/80%            .hss..P.hs........L.sAPGpYVhp.... 
   consensus/70%            .sss..PshGt...t..sLssAPGpYVhpp... 

MView 1.56, Copyright © 1997-2013 Nigel P. Brown

#protein: highlight amino acid physicochemical properties
hydrophobic          =>  bright-green      { A, G, I, L, M, P, V }
large hydrophobic    =>  dark-green        { F, H, W, Y }
cystein              =>  yellow            { C }
negative charge      =>  bright-blue       { D, E }
positive charge      =>  bright-red        { K, R }
polar                =>  purple            { N, Q }
small alcohol        =>  dull-blue         { S , T }
any       => dark-gray                     { X }
#protein consensus: report conserved physicochemical classes, derived from the Venn diagrams of Taylor W. R. (1986).
# The classification of amino acid conservation.
#J. Theor. Biol. 119:205-218.
alcohol          =>  o       { S, T }
aliphatic        =>  l       { I, L, V }
aromatic         =>  a       { F, H, W, Y }
charged          =>  c       { D, E, H, K, R }
hydrophobic      =>  h       { A, C, F, G, H, I, K, L, M, R, T, V, W, Y }
negative         =>  -       { D, E }
polar            =>  p       { C, D, E, H, K, N, Q, R, S, T }
positive         =>  +       { H, K, R }
small            =>  s       { A, C, D, G, N, P, S, T, V }
tiny             =>  u       { A, G, S }
turnlike         =>  t       { A, C, D, E, G, H, K, N, Q, R, S, T }