Reference sequence (1): ralso-hboh
Identities normalised by aligned length.
Colored by: consensus/70% and property
  1 ralso-hboh       100.0%  PSFV---GTVTVTRHDGANDDLLTAGLGAAGL-ASASAPSVATPTAPTAAELRRLDIYASYRALVDTAANGGYGTLYGP--SVDVNG--NATSGSGMVPGVEYIAYSD--DGT------- 
  2 ralpj-b2uat7      82.9%  PAFA---GKVTINRYDGISDDLLTAGLGASGL-ASATAPAIANPTAPTAAELRRLAIYANYRALVDTAAKGGYGTLYGP--NVDASG--NVTQGSGMIPGTEYVTYSD--DGT------- 
  3 cupnh-hboh        58.9%  PANI---GTVTINSYNGTTDDLLTAGLGKDGL-ASATAPLPANPTAPTAAELRRYAIHTNYRAIVDTTASGGYGSLYGP--NVDAQG--NVTGSDGKVAGVEYLAFSD--DGS------- 
  4 cuptr-b3r2m0      59.8%  PAYI---GAVTINSYDGASDDLLTAGLGKDGL-ASSTAPLPLNPAAPTAAELRRYAIYTNYRAIVDTSAGGGYGSLYGP--NVDAQG--NVTGSEGKVAGVEYVAYSD--DGS------- 
  5 cupnj-hboh        58.2%  PANI---GTVTIQAYDGATDDLLTAGLGKDGL-ASATAPVPASPNSPTAAELRRYAIYTNYRAIVDTTAGGGFGSLYGP--NVDAQG--NVTTGQGKIAGVEYLAFSD--DGS------- 
  6 9burk-a0a0c4yad2  60.9%  PANI---GTVTIKTYDGNTDDLLTAGLGKDGL-GSATAPLPLNPAAPTAAELRRYAIYTNYRALVDTTAGGGYGSLYGP--NVDAQG--SITTGQGKVAGREYLAFSD--DGS------- 
  7 9burk-a0a069i4i2  59.1%  PANI---GAVAITTYDGNTDDLLTAGLGKDGL-GSATAPVPLNPAAPTAAELRRYAIYTNYRALVDITVGGGYGSLYGP--NVDAQG--NVTSGQGKVAGREYLAFSD--DGS------- 
  8 9burk-v2ivt7      59.4%  PAYI---GSLTVHDYDGNADDLLTAGLGKDGL--AGTAPLPADPNAPTRTELRRYAIWSNYQALVDVSAAGGYGTLYGP--NVDAQG--NVTGGQGKIPGVEYLAYAD--DGS------- 
  9 9burk-a0a1g6iei9  59.1%  PAFV--VGTVKIQSYDGTSDDLLTAGLGKDGI-GSATAPVPANPAAPTAAELRRYAIYNNYRAIVDTNPLGGYGTLYGP--NVDAQG--NVTTGQGKIAGTEYLAFAD--DGS------- 
 10 9burk-a0a1i1cz09  58.7%  PTFV--VGTIGVQNYDGTTDDLLTAGLGKDGLIATATAPVPADPAAPTAAELRRIAIFNNYRAIVDTNPLGGYGSLYGP--NVDPQG--NVTASQGKVPGTEYIAFAD--DGT------- 
 11 9rals-a0a1h0kna3  57.2%  PTFI--VGTISVKSYDGSSDDLLTAGLGKDGL-AAAAAPAFADPTAPTAAELRRNAIFVNYRAIVDVQAAGGYGSLYGP--NVDAQG--NVTASQGKVPGTEYLAFAD--DGT------- 
 12 aciac-hboh        58.7%  PSYL---NDLRQASYDGAGNDLLTGGLGRSGL-QDDSPPGYAG-SQPTAEELRRNAIYVNYRALVDTTSEGGYGRLYGP--NVDAQG--RATSGEGMVAGTEAIAYSD--DGS------- 
 13 9burk-a0a1i1tgt8  58.2%  PTYL---NDIRQTTYDGVGDDLLTAGMGRTGL-QDDQAPGYEG-SQPTAEELRRNAIYTNYRALVDTTTAGGYGTLYGP--NIDAQG--RVGSGEGKVAGLEAIAYSD--DGT------- 
 14 9burk-a0a0q4rum3  57.4%  PAYL---GAISETSYDGTSNDLLTAGLGASGL-AAALPPASADPLKPTAAELRRTAIHTNYRGMLDMTAAGGYGLLYGP--NVDAQG--KVTTGEGKVAGTEYIAFAD--DGT------- 
 15 9burk-a0a0q6zbr6  57.4%  PTYL---GAISEITYDGTSNDLLTAGLGATGL-AAAVPPAYADPLKPTAAELRRTAIHTNYRAMLDMTAAGGYGTLYGP--NVDAQG--KVTTGEGKVAGTEYIAFAD--DGT------- 
 16 9burk-k0i392      57.4%  PAYL---GAISEATYDGTSNDLLTAGLGATGL-AAAVPPAYADPLKPTAAELRRTAIHTNYRAMLDMTAAGGYGTLYGP--NVDAQG--KVTTGEGKVAGTEYIAFAD--DGT------- 
 17 9burk-a0a165i0t6  58.2%  PGYL---GTISETTYDGSSNDLLTAGLGATGL-AAAVPPAFADPLKPTAAELRRTAIHTNYRAMLDMTAAGGYGTLYGP--NVDAQG--KVTTGEGKVPGTEYIAFAD--DGT------- 
 18 9burk-h0bzn8      57.0%  PAYL---GAISAVTYDGTSNDLLTAGLGASGL-AAPVAPAYADPLNPTAAELRRTAIHTNYRAMLDMTAAGGYGTLYGP--NVNAQG--QVTAGDGKVAGTEYIAFAD--DGT------- 
 19 9burk-j1eg31      59.3%  PAYL---GSITETRYDGTGNDLLTAGLGASGL-ASATPPAYADATKPTGAELRRAAIYNNYRAMLDMTAAGGYGTLYGP--NVDAQG--RVTTGDGKVPGTEYIAYAD--DGS------- 
 20 comt2-d0j2k4      58.6%  PGYL---GTVRQQSYDGSSDDLLTAGLGKSGL-AVATAPGFASALQPTAAELRRLAIYTNYRAMLDMTAAGGYGTLYGP--NVDAQG--RVTAGEGRIAGTEYIAFSD--DGT------- 
 21 9burk-a0a0q4y4j2  56.9%  PAFI---GNVQQTEYDGSTDDLLTAGLGKTGL-AGA-APGYANAAAPTAAELRRHAIYTNYRALLDMTAAGGYGLLYGP--NVAVDG--TVTTGEGKVAGGEYVAYAD--DGT------- 
 22 9burk-a0a0s9ndl4  58.1%  PDFV---GTVTMLEYDGSRDDLLTAGLGKTGL-AGA-APGYANAAAPTAAELRRNAIYNNYRALLDMTAAGGYGVLYGP--NVALDG--TASLGEGKVAGGEYIAFSD--DGS------- 
 23 9burk-a0a0u3d7f1  59.4%  PDFV---VGLKSASYDGVADDLLTAGLGKTGL-ASATLAAYADPLKPTAAELRRAAIYTNYRAIVDVAANGGYGTLYGP--NVAADG--TVGTGEGKVAGTEYLAYSD--DGT------- 
 24 9burk-h5wj03      59.5%  PAFI--QGEIRRTDYDGVADDLLTAGLGQAGL-ATA-APTFANPLAPTAAELRRLHIVNSYRAIVDTTAGGGYGTLYGP--TVAADG--TVTAGDGKVAGTEWLAFSD--DGS------- 
 25 rhoft-hboh        51.5%  PAYL---GEVASASYDGISDDLLTAGLGKTGL-GGA-APAVVDPLSPTSAELRKLAIFNNYRAILDITAGGGYGTLYGP--NVDAKG--VVGASEGMIAGTEYIAYSD--DGT------- 
 26 polna-hboh        52.1%  PAYL---GAVAIASYDGASDDLLTAGLGKTGL-GGT-APAVADPLKPTPAELRRLAIFNNYRAILDISTNGGYGTLYGP--NVDAKG--VITTGEGKIAGTEYIAYSD--DGT------- 
 27 polsj-hboh        52.3%  PTYL---GTVVSVNYDGASDDLLTAGLGKTGL-GAT-APVAADPLNPTAAELRRIAIFNNYRALLDISVAGGYGSLYGP--NVDASG--VITTSEGKIAGTEYMAYSD--DGT------- 
 28 9burk-a0a1i7i9y5  51.5%  PPYV---GVITVGVYDGGNDDLLTAGLGKTGL-AAP-APQPVDPLNPSAAELRRIAIYNNYRAILDISPGGGYGTLYGP--NVDARG--NVTAGEGKIAGTEYITYSD--DGS------- 
 29 9burk-j2kx41      51.7%  PAYL---GPISVGVYDGGNDDLLTAGLGKSGL-GGA-APQPADPLKPTPAELRRIAIYNNYRAILDISPAGGYGTLYGP--NVDARG--VATTGEGKIPGTEYIAYSD--DGS------- 
 30 9burk-a0a1h3llv4  52.0%  PPYV---GTISATAYDGNTDDLLTGGLGKTGL-TSATAPSPVDATAPTAAELRKIAIYTNYRAVLDATPAGGFGVLYGP--NIDVSG--KDTLGEGKIAGTEYIAYSD--DGS------- 
 31 9burk-a0a0q8qlw9  52.2%  PSYL---GTIQKATYDGVSNDLLTAGLGRTGL-QAA-APAFADPANPTIAELRRNAIHSNYRALIDPSTNGGFGTLYGP--NIDNAG--NATLGEGKIAGDEYIAYAD--DGT------- 
 32 9prot-a0a1p8fhr2  51.8%  PDFV--KGTILKTAYDGTTDDLLTAGLGKSGL-QAA-LPAFADPANPTVAEIRRQAIYNNYRALVDMTTNGGYGTLYGP--NVDSTG--AVTPSEGKIAGEETIAYAD--DGT------- 
 33 9burk-a0a0m2wss7  46.6%  PGYL---GTITRADYDGKTNDLLTAGLGKTGL-AGA-APAYANVEQPTPLELRRNAIYANYRAVLDIAANSGYGTLYGP--NVDASG--NVGTGEGLIPGSEYIAYAD--DGT------- 
 34 9burk-a0a255hvv2  47.0%  PDYL---GAITRLDVDGKTNDLLTAGLGKTGL-AAA-VPAYADPERPTALELRRNAIHANYRAVLDIAANSGYGSLYGP--NVDANG--VAGSGEGLIAGSEYVAYAD--DGT------- 
 35 9burk-a0a1h8cn61  46.3%  PSYL---GDISSKTYDGVSDDLLTAGLGKTKL-ALA-APAYADPANPTAAELRRNAIHANYRAVLDISANSGYGTLYGP--NVDAKG--VPGAGEGMIAGTEYIAYAD--DGS------- 
 36 9burk-a0a0x8gl12  48.4%  PAWL---GNVSQNNLDGVSNDLLTAGLGKSGL-ALA-LPAHADPAKPTPTELRRAAIYNNYRALVDISSSGGYGRLYGP--NIDISG--NDTLGEGKIAGEEYLAYAD--DGT------- 
 37 9neis-a0a2g3jcr7  48.2%  PSWL---GNVSQNSFDGVSNDLLTAGLGKSGL-ALA-LPAFADPARPTPAELRRAAVYNNYRALVDISSSGGYGRLYGP--NIDISG--NDTLGEGKIAGEEYLAYSD--DGS------- 
 38 9burk-a0a1k2h8v5  48.7%  PGWL---GSIASKTYDGTSDDLLTAGLGKTGL-AGA-RPAFADASAPTAAELRRDAIYNNYRALVDMTTTGGYGRLYGP--NIDRSG--NDSLGEGKIAGEEHIAFAD--DGT------- 
 39 9burk-a0a0c1yp15  50.4%  PSFI--RGAVRSQTYDGISDDLLTAGLGAAGL-AGT-APAIVNPASPTAAELRRLAIWSNYRALVDVAANGGYGRLYGP--NVTADG--TVTGSAGKIAGKEFIAYAD--DGS------- 
 40 rubgi-i0hxc6      49.4%  PAGV--RGPVTETVYDGVADDLLTAGLGKTGL-MGA-APAFADPLHPTPAELRRNAIYVNYRALVDYTAAGGMGVFYGP--NIDAEG--RDTLGEGKVPGRETLAWYD--DGS------- 
 41 lepcp-b1xzg8      46.9%  PTAV--RGAVTVSTYDGATDDLLTAGLGRAGL-MGG-APTYVDAAAPTAAELRRNAIYNNYRALVDPTALGGMGTLYGP--NVDTAG--SATNNAGLIAGREYIAWAD--DGT------- 
 42 azosb-hboh        50.0%  PSFL---GEIVQRSVDGVSDDLLTAGLGRDGI-QSATPPLVS--ASPTATELRRLAIYNNYRALVDTTSGGGFGSLFGPLIAVDAGGR-VSAPGDGKIAGTEYLAYAI--DRG------- 
 43 9rhoo-h0pzw5      51.5%  PAFL---GDVISRDTDGISDDLLTAGLGRAGI-QSGTAPVVS--AVPTADELRRLAIYNNYRALIDTSPNGGYGTLFGPLTSVSATGV-VSSSGDGKIAGSEYLAYAN--HGG------- 
 44 parxl-hboh        50.4%  PAFI-TASSVRTQFYDGNTDDLLTAGLGKTGL-ASATAPAIANAAQPTAAELRRLAIWSNYRALVDMTANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--DGS------- 
 45 9burk-a0a248vv48  49.9%  PNFI-ASTSVRTQSYDGNTDDLLTAGLGKTGL-ASAAAPAVANAAQPTAAELRRLAIWANYRALVDMTANGGYGRFWGP--NVDVNG--NDTLGEGKIAGKEYLAFAD--DGT------- 
 46 9burk-a0a1m6k1z0  50.3%  PSFI--KSAVKTQSYDGNADDLLTAGLGKTGL-ASATAPAIANPAQPSAAELRRLAIWSNYRALVDMTANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--DGS------- 
 47 bursg-e1teq0      50.3%  PDFI--VGTVRTQSYDGNNDDLLTAGLGKTGL-AAATAPAVANPAQPTAAELRRLAIWSNYRALVDMTSNGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--NGS------- 
 48 9burk-a0a1a9n382  49.8%  PAFI--TSAVNTQSYDGNSDDLLTAGLGKTGL-ASATAPAIANPAQPTAAELRRLAIWSNYRALVDMTANGGYGRFWGP--NIDVNG--NDTLGEGKITGKEYLAFAD--DGS------- 
 49 9burk-a0a1n7rin1  50.8%  PGFI--KSAVTTRSYDGNTDDLLTAGLGKTGL-ALATAPAIANAAQPTAAELRRLAIWSNYRALVDMTANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--DGS------- 
 50 9burk-a0a0q5pi68  50.8%  PSFI--AGSVRTQTYDGNTDDLLTAGLGKTGL-ASASAPSVANAASPSAAELRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAYAD--DGS------- 
 51 9burk-a0a158i436  50.2%  PSFI--SGSVRTQTYDGNTDDLLTAGLGKTGL-ASASVPAVANALSPTAEELRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--DGS------- 
 52 9burk-a0a158f2z2  51.1%  PNFI--SGSVRTQSYDGTTDDLLTAGLGKDGL-ASATPPAIANPAAPSAADLRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGMIAGKEYLAFAD--DGS------- 
 53 9burk-a0a069pj40  50.6%  PNFI--AGSVNTQTYDGNTDDLLTAGLGKTGL-ASATPPAIANAVKPTAAELRRLAIYSNYRALVDMTTNGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--NGS------- 
 54 9burk-a0a158fjp6  50.7%  PNFI--AGSVKTQTYDGSTDDLLTAGLGKTGL-ASATPPAIANAAQPTAAELRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--NGT------- 
 55 9burk-a0a158i7p9  50.3%  PNFV--SGSVKTLTYDGSTDDLLTAGLGKTGL-ASATAPTIANALQPTAAELRRLAIYSNYRALVDMTANGGYGRFWGP--NVDLNG--GDTLGEGKIAGKEYLAFAD--DGS------- 
 56 9burk-a0a158j083  49.8%  PNFV--AGSVKTQSYDGNTDDLLTAGLGKTGL-ASATPPTIASPAQPTAAELRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYLAFAD--DGS------- 
 57 9burk-a0a157ze58  50.8%  PAFV--SGSVNTQTYDGTSDDLLTAGLGKTGL-ASASAPGIAKPAAPTSAELRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYIAYSD--DGS------- 
 58 9burk-g8m711      49.8%  PNFV--AGSVNTQTYDGVSDDLLTAGLGKTGL-ASTTAPGIANNAAPTAAELRRLAIYSNYRALVDMSANGGYGRFWGP--NVDLNG--NDTLGEGKIAGKEYIAYAD--DGS------- 
 59 9burk-a0a158bp80  50.8%  PSFI--AGSVNTQTYDGVSDDLLTAGLGKTGL-ASATAPSIAKPAAPTAAELRRLAIYSNYRALVDMSANGGYGRFWGP--NIDLNG--NDSLGEGKIAGKEYIAFAD--DGS------- 
 60 9burk-r4wsp2      50.6%  PNFV--SGAVNTQTYDGVSDDLLTAGLGKTGL-ASATSPSIANPAAPTAAELRRLAIYSNYRALVDMSASGGYGRFWGP--NIDLNG--NDTLGEGKIAGKEYIAYAD--DGS------- 
 61 9burk-a0a0a6qad6  49.5%  PSFV-VAGSLRTTSYDGVSDDLLTAGLGKTGL-AGA-APSIANPAAPTAAELRRLAIWSNYRALVDMSANGGYGRFWGP--NVDVYG--DDTLGEGKIAGTEYLAYAD--EGS------- 
 62 9burk-a0a1g7byt2  49.6%  PAFV-VPGSLQTTSYDGVDDDLLTAGLGKTGL-AGP-QPAIANAAAPTASELRRLAIWSNYRALVDITANGGYGRFWGP--NVDLYG--NDTLGEGKIAGAEYLAYAD--DGA------- 
 63 parp8-b2jvh3      48.6%  PPFV-VADSLRTTVYDGVSDDLLTAGLGKTGL-AGA-APAIANPAAPTAAELRRLAIWSNYRALVDMTANGGYGRFWGP--NVDLSG--GDTLGEGKIAGTEYLAYAD--DGT------- 
 64 9burk-a0a1q8iw17  47.0%  PSFV-VPGSLSTVTYDGSTDDLLTAGLGKTGL-ASAVAPAIANPISPTAAELRRLAIWSNYRALVDMTTAGGYGRFWGP--NVDLDG--NDTLGEGKIAGTEYLAYAD--DGS------- 
 65 9burk-b5wc15      47.5%  PSFI-VASSLSTITYDGVSDDLLTAGLGKTGL-QSPVAPAVANPASPTAAELRRRAIWSNYRALVDMTSTGGYGRFWGP--NVDLDG--SDTLGEGKIAGTEYLAYAD--DGS------- 
 66 parcy-a0a1x7gjk2  49.5%  PPFV-VAGSLRITSYDGTADDLLTAGLGKTGL-AGA-APAVADPANPTAAELRRLAVWSNYRALVDMTANGGYGRYWGP--NVDLDG--NDTLGEGKIAGTEYLAYAD--DGS------- 
 67 9burk-a0a1l6hzb8  50.5%  PAFV-VSSSMTTTFYDGNSDDLLTAGLGKTGL-AGA-APGFANPSAPSSAELRRLAIWSNYRALVDITANGGYGRFWGP--NIDLNG--NDTLGEGKIAGTEYIAYAD--DGS------- 
 68 9burk-a0a142ywf2  50.5%  PSFV-VSGSVTTTAYDGNSDDLLTGGLGKTGL-GSATAPSFANAASPTAAELRRLAIWSNYRALVDMSSNGGYGRFWGP--NVDLNG--NDTLGEGKIAGTEYLAYAD--NGT------- 
 69 burvg-hboh        50.5%  PVFV--SGSVRTTAYDGASDDLLTAGLGKTGL-ASAAAPAFADPSRPTAAELRRVAIWSNYRALVDMSANGGYGRFWGP--NVDLDG--NDTLGEGKIAGTEYLAYAD--DGS------- 
 70 9burk-b1t7h7      50.2%  PGFV--SGSVRTTAYDGTSDDLLTAGLGKTGL-AS-TAPAFANPSRPTSAELRRLAIWSNYRALVDMSANGGYGRFWGP--NVDLDG--NATLGEGKIPGTEYLAYSD--DGS------- 
 71 burm1-a0a0h3kh69  51.2%  PGFV--SGDVRTTAYDGTSDDLLTAGLGKTGL-ASATAPAFANPSRPTSAELRRLAIWSNYRALVDMSANGGYGRFWGP--NVDVDG--NATLGEGKIAGTEYLAYSD--DGS------- 
 72 9burk-u2gbn1      50.5%  PGFV--SGNVRTTAYDGASDDLLTAGLGKTGL-GSATAPGFANAARPTSAELRRLAIWSNYRALVDMSANGGYGRFWGP--NVDLDG--NDTLGEGKIPGTEYLAYSD--DGS------- 
 73 burcj-b4ecv6      51.1%  PGFV--AGSVRTTAYDGASDDLLTAGLGKTGL-AAASAPGFANPARPTSAELRRLAIWSNYRALVDMSANGGYGRLWGP--NVDLDG--NDTLGEGKIAGAEYLAYAD--DGS------- 
 74 9burk-a0a119uvu7  50.3%  PGFI--AGSVRTTAYDGASDDLLTAGLGKSGL-ASAVPPAFANPARPTAAELRRLAIWSNYRAIVDMSANGGYGRFWGP--NVDLDG--NDTLGEGRIAGTEYIAYSD--DGS------- 
 75 burps-hboh        49.8%  PGFV--SGSVRKTAYDGASDDLLTAGLGKTGL-GSDTRPGFANPAQPSAAELRRLAIYSNYRALVDITPNGGYGRFWGP--NVDLAG--NDTLGEGKIAGTEYLAYSD--DGS------- 
 76 9burk-a0a0d5lcs9  50.0%  PGFV--SGSVRKTTYDGASDDLLTAGLGKTGL-GSDTRPGFANPAQPSAAELRRLAIYSNYRALVDITPNGGYGRFWGP--NVDLAG--NDTLGEGKIPGTEYLAYSD--DGS------- 
 77 9burk-a0a103ehy2  49.7%  PDFI--AGKVSVSAYDGASDDLLTAGLGKTGL-GSATRPGFANPAQPSAAELRRLAIYTNYRALVDITPNGGYGRFWGP--NVDLSG--NDTLGEGKIPGTEYLAYSD--DGS------- 
 78 9prot-a0a0n1b5s2  52.4%  PSYI---RAVSVLSYNGSTDDLLTGGLGWDGL-AGA-APAVS--ATPTAAELRRRAIYNNYRALVDFTAAGGYGRLYGP--NVALDGTVNSTAGAGKIAGKEYIAYADP-DGS------- 
 79 9burk-a0a059kik8  53.0%  PSWL---GSVSAAAYDGSSDDLLTAGLGKSGL-GSATAPTFATPTAPTAAELRRLAIHTNYRALADMTANGGYGRLYGP--NIDLAG--NDTLGEGRIAGIEYRALMD--DGS------- 
 80 marhv-hboh        41.3%  PDFL--VSDVRQFDYDGNTDDLLTAGLGPEGL-ASATPPAFVDALNPTPAELRRLAIYNNYRALVDTAPGGGYGSLFGP--AVGNAS--------GRIPGQEFIAMMQV-PGA------- 
 81 9alte-a0a1i6h326  43.4%  PEFV--RGDVQHTRYDGVTDDLLTAGLGASGL-ASTPAPAFVNPLNPEPAELRRLAIYNNYRALVDTVPGGGFGTFFGP--QVGVGG-------EGLIPGDEYIAFMSV-PGT------- 
 82 9alte-a0a2g1vdq6  41.9%  PDFI--QGDINQSSYDGITNDLLTAGLGASGL-ASTTAPAFTDALNPAPAELRRLAIYNNYRALVDTAPGGGYGAFFGP--QVGNGG-------EGWIPGDEYIAYMAV-PGT------- 
 83 9alte-a0a0p8apl5  43.1%  PDFV--QGDIHSAQYDGTTNDLLTGGLGASGL-AGG-APAFDDPLNPTPEELRTLAIYNNYRALVDTAAGGGYGEFFGP--QVGSGG-------EGLIPGEEHLAYMSV-EGS------- 
 84 9alte-a6f5e1      41.9%  PGFI--QGDVHSTQYDGVTNDLLTGGLGASGL-ASATAPAFDDPINPTPEELRTLAIYNNYRALVDTVPGGGYGEFFGP--QVDSSG-------EGLIAGNEYLAYMTV-NGS------- 
 85 9alte-a0a072mx50  42.9%  PDFV--RGNVEQAHYDGITDDLLTAGLGASGL-ADATKPTFADPLNPTPAELRRLAIYNNYRALVDTVPGGGYGEFFGP--QVDASG-------EGMIAGTEYRALVSV-PGR------- 
 86 9alte-r8b0j8      41.3%  PDFI--SGDIQQTWYDGQTDDLLTAGLGADGL-ASATPPAFDDALNPPPAELRRLAIYNNYRALVDTAPGGGYGTFFGP--TVGVDG-------NGLIAGEEFLALMTV-AGH------- 
 87 9alte-n6wvv7      44.2%  PDVV--SGNIQHTRYDGASNDLLTAGLGASGL-ASATAPTPADPINPTAEELRTLAIYNNYRALVDTSAGGGYGNLFGP--QVDADD------AEGMIPGDEYLAYIRL-DEA------- 
 88 9prot-a0a0d2sri5  44.6%  PGFV--RGGILHERYDGRTDDLLTGGLGSAGL-ANPSPPTFADPSHPTAAELRTRAIHANYRALVDMTPGGGYGTLYGP--AVGIGG-------LGMIAGHEYLALADHGDGS------- 
 89 9prot-w9h9a9      43.6%  PDFV--RGDLQRTYFDGKTNDLLTGGLGSAGL-ANATPPAFADPANPTAAELRTRAIHANYRALVDMTPGGGYGSLYGP--AVGIGG-------AGLIAGHEYIALAD--GGRR----HG 
 90 9chlr-a0a2h3l7f5  45.0%  PAFM--RGAIIRATYDGDTDDLLTAGLGQAGL-QGA-APVAADPLNPTAAELRRLAIYTNYRAIVDVTPGSGYGTLYGP--AVGTGA-----TASGKIAGKEYLAYAD--DGT------- 
 91 causk-b0t3v3      39.4%  PTWLE-LGP--RTRHDGPADDL-------TGL-AAKPGP-YADPLHPTAAELRRQTMASTFDS------AAGWGRLLGP--TINVATG-QPYPDGGRVSGEEQLAYARV-DGA------- 
 92 strhy-FKBW        12.7%  LSQLRVPAA--ARQQADCLDELTTAGTAATG-----------------------------------HTDPADWAGLTPK-NLATPTG----------VPGIQIDGYFP--DTSTTNTNHG 
 93 9actn-a0a0g3avt9  14.1%  RTGLRVPGA--ARQQADCLDELTTAGTVASG-----------------------------------HTDPADYAGLTPK-DLPTPSG----------VPGIQIDGYFP--DSSTTDTNHG 
 94 9actn-a0a1d7ykt0  13.2%  RAHLRVPGA--ARRQADCLDELTTAGTVASG-----------------------------------HTDPADYAGLTPK-GLPAPTG----------VPGIQIDGYFP--DTSTTNTHHG 
 95 9actn-a0a101p6p6  13.8%  RTHLRVPGA--ARQQADCLDELTTAGTVASG-----------------------------------HTDPADYAGLTPE-DLPTPSG----------VPGIQIDGYFP--DTSTTNTDHG 
 96 strrc-v6jsq5      13.0%  RTQLRVPGA--ARQQADCLDELTTAGTVASG-----------------------------------HTDPADYAGLTPQ-DLPTPSG----------VPGIQIDGYFP--DTSTTNTDHG 
 97 9actn-a0a0j8alc0  13.6%  QALLHVPGA--ARQQADCLDELTTAGTVATG-----------------------------------HTDPADYAGLTPK-DLSTPSG----------VPGIQIDGYFP--DTSTTNTNHG 
 98 strhj-h2jv72      14.1%  QARLHVPGA--AHQQADCLDELTTAGTVATG-----------------------------------HTDPADYAGLTPK-DLPTPSG----------VPGIQIDGYFP--DTSTTNTNHG 
 99 9actn-a0a1q5kj90  14.1%  QDRLRVPGA--ALQQTDCLDELTTAGTVASG-----------------------------------HTDPADYAGLTPK-DLATPSG----------VPGIQIDGYFP--DTSTTNTNHG 
100 9actn-a0a1q5jti2  13.3%  ESRLRVPGA--AHQVTDCLSELTTAGTVASG-----------------------------------HTDPADWAGLTPK-DLAVPGG----------VPGIQIDGYFP--DSSTTNTNHG 
101 9actn-a0a170yun5  12.8%  ---------------------------MESG-----------------------------------HTDPADWAGLTPE-GLAVPQG----------VPGIQIDGYFP--DSSTTNTNHG 
102 strvd-d5zzz8      13.5%  ------------------------------------------------------------------HTDPADWAGLTPQ-GLAVPEG----------VPGIQVDGYFP--DSSTTNTNHG 
103 9actn-d9xmy1      12.8%  QSHLRVPGA--AHQRSDCLNELTTAGTVASG-----------------------------------HTDPADWAGLTPK-DLTVPEG----------VPGIQIDGYFP--DSSTTNTNHG 
104 9actn-a0a1v6msd3  13.9%  LARLRVPGA--AHQQADCVAELTTAGTVASG-----------------------------------HTDPADWAGLTPK-GLTVPSG----------VPGIQVDGYFP--DTSTTNTNHG 
105 9actn-a0a231pik6  14.5%  PTSVRVPGA--EHQQSACLAELTTAGTVASG-----------------------------------HTDPADWAGLTPK-DLAVPSG----------VPGVQIDGYFP--DTSTTNTNHG 
106 9actn-a0a243s7n5  14.0%  LTEVRVPGA--QHQQAACLDELTTAGTIASG-----------------------------------HTDPADWAGLTPQ-YLAVPSG----------VPGIQIDGYFP--DTSTTNTNHG 
107 strvt-d9x4g9      13.6%  PTKARVPGA--EHQQAACLDELTTAGTIASG-----------------------------------HTDPADWAGLTPK-DLAVPSG----------VPGIQIDGYFP--DTSTTNTNHG 
108 strga-a0a089wz13  13.5%  LDRVRVPGA--ERQRAACLAELTTAGTAASG-----------------------------------HTDPADWAGLTPK-DLAVPSG----------VPGIQIDGYFP--DSSTTNTNHG 
109 stra4-a0a0b5em56  13.8%  QGQLHVPGA--AHQQAACLAELTTAGTADSG-----------------------------------HTDPADWAGLTPA-GLSVPRG----------VPGIQIDGYFP--DTSTTNTNHG 
110 9actn-a0a1b9f0r1  13.8%  QDAIRVPGA--ARQQVDCLAELTTAGTVASG-----------------------------------HTDPADWAGLTPE-GLATPSG----------VPGIQIDGYFP--DTSTGNTNHG 
111 9actn-v6u5a7      13.4%  ---------------------------MTSG-----------------------------------HTDPADWAGLTPE-GLATPSG----------VPGIQIDGHFP--DTSTGNTNHG 
112 strgg-b1vv39      13.8%  PDTIEVPGA--AHQQAACLAELTTAGTVASG-----------------------------------HTDPADWAGLTPK-DLATPRG----------VPGLQIDGYFP--DSSTGNTNHG 
113 strnv-v6jhg3      13.0%  MAALAVPGA--ARQQAACLPELTTAGTVASG-----------------------------------HTDPADWSGLTPK-DLATPSG----------VPGIQLDGYFP--DSSTTNTTHG 
114 9actn-a0a1z1w3d1  15.0%  LDQLHVPGA--ERQRPACLGELTTAGTVGSG-----------------------------------HTVPADWAGLTPK-DLPTPTG----------VPGIQIDGHFP--DTSRTNTHHG 
115 9actn-a0a0c1vxf7  14.1%  LSRLKVPGA--PLQVRSCLDELTTAGTVASG-----------------------------------HTEQADWAGLTPA-GLSVPSG----------VPGIQVDGYFP--DSSSGNTHHG 
116 9actn-a0a1e7kkk9  14.4%  TPHLRVPGA--EHQRVACLDELTTAGTVDSG-----------------------------------HTDKADWAGLTPK-DLRTPRG----------VPGIQLDGYFP--DSSHGNTNHG 
117 9actn-a0a1d7vlb5  13.5%  AARLHVPGA--ARQQLSCLDGLTTADTVTSG-----------------------------------HTDPADWAGLTPA-GLAAPRG----------VPGVQIDGYFP--DTSATNGHHG 
118 9actn-a0a1c6lyy5  14.1%  TDVPRVPGA--AHQQAACLEELTTAGTVASG-----------------------------------HTDPADWAGLTPA-KLPTPRG----------VPGLQIDGYFP--DSSTTNTNHG 
119 9actn-a0a1c6nj41  14.4%  TDMPRVPGA--EHQKAVCLDELTTAGTVESG-----------------------------------HTDPADWAGLTPA-KLPTPKG----------VPGVQIDGYFP--DSSATNTNHG 
120 9actn-a0a1e7jip1  13.6%  TDMPRVPGA--EHQKAACLEELTTAGTVGTG-----------------------------------HTDPADWAGLTPE-KLPTPSG----------VPGVQIDGYFP--DTSATNTNNG 
121 9actn-a0a1e7kw84  14.4%  TDVPRVPGA--EVQRAACLAELTTAGTVGSG-----------------------------------HTDPADWAGLTPE-KLPVPRG----------VPGVQIDGYFP--DTSTTNTNNG 
122 9pseu-i0v4y5      13.9%  QRHLRVPGA--RHQQVACLDDLTTTGTVRTG-----------------------------------HTDPADWAGLTQS-ALPVPGP----------VPGIQIDGYFP--DTSTTNTNHG 
123 9actn-v6knz8      12.5%  LDHVRVPGA--AQQQADCLTELTTAGTVDSS-----------------------------------HTVPADWAGLTAS-GTDVPTG----------VPGIQIDGYFP--DASAGNTHHG 
124 9pseu-a0a1h5qih7  14.1%  ---VSVPGA--SKAVSVCLDDLTTTGTLASG-----------------------------------HTVEADWAGLTSA-GLPTYGR----------VPGVQVDGYFP--DTSTANTNNG 
125 9pseu-r1i3m0      14.3%  ---ADVPGA--QRQVAACLDDLTTTGTVASG-----------------------------------HTVEADWAGLTSA-GLPTFGA----------VPGVQVDGYFP--DTSTANTNHG 
126 9pseu-a0a1q9lh88  13.4%  ---VRVPGA--AEQRSACLSDLTTTGTSASG-----------------------------------HTVPADWAGLTPA-GLPVPGA----------VPGVQVDGYFP--DSSTTNTNNG 
127 9actn-a0a1n6wgk4  14.5%  P-RVTVPGA--QKQVTACLDDLTTKGTLVSG-----------------------------------HTDQSDWSGLNSP-GAVNPSG----------VPGMQIDGYFP--DTSTGNTNHG 
128 9mico-a0a0a0jbp0  13.5%  QAKAQVPGA--EMQKVACLDDLTTAGTVASG-----------------------------------HTKPGDYAGLVTP-GTVNPTG----------VPGIQIDGYFP--DTSTTNVNNG 
129 9mico-a0a0a0jwc4  13.5%  QSKVAVPGA--EQQKVACLDDLTTAGTVASG-----------------------------------HTRAADFAGLHTP-GTVNPTG----------VPGIQVDGYFP--DTSTTNTNNG 
130 9mico-a3tg58      12.9%  QSKIAVPGA--EKQKVSCLDDLTTAGTIPSG-----------------------------------HSVAADFAGLHTP-GTVNPTG----------VPGIQVDGYFP--DRSTTNVNNG 
131 9mico-a0a0q9lt59  15.3%  QSKIRVPGA--EVQTLACLDDLTTAGTVASG-----------------------------------HTNPGDWAGLNAA-GTVNPTG----------VPGIQVDGYFP--DTSTTNTNHG 
132 9mico-a0a0t2ikk7  13.4%  QSKVAVPGA--QAQKVACLDDLTTAGTVASG-----------------------------------HTNPNDWAGLNAA-GTVNPTG----------VPGIQADGYFP--DTSTTNTNNG 
133 9actn-a0a239adt9  13.2%  --GLAVPGA--EKQVAACLDDLTTAGTVGSG-----------------------------------HTVPADWAGLHAA-GTRNPSG----------VRGVQLDGYFP--DTSTFNTNHG 
134 9actn-a0a1i5y3q1  13.5%  MNRVRVPGA--VHQVAACLDDLTTAGTVASG-----------------------------------HTDKSDWEGLHSA-ATRNPSG----------VPGIQIDGYFR--DDSSFNTTHG 
135 9actn-a0a239p629  14.0%  LDRVRVPGA--ERQVAACLDDLTTAGTVASG-----------------------------------HTVKVQWTGLHAA-ATANPSG----------VPGIQIDGYFR--DGSSFNTTHG 
136 9actn-a0a0c5g9u7  13.7%  QERVRVPGA--ALQRSTCLPDLTTTGLADTP-----------------------------------YTDLGDQAGLTAS-ATRTPSG----------VPGIQVDGYFP--DTSRFNATHG 
137 9actn-a0a086n6p2  13.5%  QERVRVPGA--ALQRTACLDDLTTAGLAGTP-----------------------------------YTDMADQAGLTAG-GTRRPSG----------VPGIQVDGYFP--DSSRFNTTHG 
138 9actn-a0a1q5luf4  12.8%  QERVRVPGA--AHQRSACLTDLTTAGLAGTP-----------------------------------YTDMADQAGLTAE-ATRSPSG----------VPGVQIDGYFP--DSSRFNNTHG 
139 strto-a0a081xqk7  12.2%  QDRVRVPGA--AHQRSACLADLTTTGLAGTP-----------------------------------YTDMADQAGLTAA-ATRSPSG----------VPGVQIDGYFP--DSSRFNDTHG 
140 9actn-a0a124f0u4  13.0%  QEKVRVPGA--AFQQSACLYDMTTSALAGTP-----------------------------------YTDMADQAGLTAK-DTRSPSG----------VSGLQIDGYFP--DDSHTNTTHG 
141 9actn-a0a1e5p2p5  12.5%  PDLPRVPGA--EHQRVACLPDLTTAGLAGTA-----------------------------------YTDIADQAGLSAK-GTKNPSG----------VPGTQIDGYFP--DDSRFNATHG 
142 9actn-a0a1q5j3v0  13.0%  QDRLRVPGA--EHQRSACLDDLTTAGLAGTR-----------------------------------YTDLADQAGLAAK-GTRNPSG----------VPGVQIDGYFP--DDSRLNATHG 
143 9actn-a0a239d1v8  13.3%  LDRVTVPGA--EHQQKACLPDMTTTALAGTA-----------------------------------YTDTADQAGLAAA-GTTRPSG----------VPGVQVDGYFP--DTSGFNTTHG 
144 9actn-a0a0n1fwk5  11.6%  QSRITVPGA--AFQTLACLPDMTTAATAGTA-----------------------------------YTDSADWASLTAK-GTKNPTG----------VPGIQIDGYFP--DSSHLNKTHG 
145 9actn-a0a1c5chu9  12.7%  RDRVSVPGA--EFQTAACLPDLTSTALAGTQ-----------------------------------YTDSTDWSPLFAK-GTENPSG----------VPGVQIDGYFP--DSSRLNATHG 
146 strfr-a0a081en77  12.2%  GDRIAVPGA--EFQTHACLPDMTTAALAGTR-----------------------------------YTDSADWSSLTAQ-GTRNPSG----------VAGLQIDGYFP--DTSRLNTTHG 
147 9actn-a0a1g8xy87  12.5%  AERVTVKGA--EHQQAVCLPDLTTAALVGTP-----------------------------------YTNPADWAGLSAQ-GTVNPSG----------VRGVQIDGYFP--DTSRLNTDHG 
148 9actn-a0a0x3szz0  12.2%  QARASVPGA--EHQESACLPDMTTTALAGTR-----------------------------------YTDTADQAGLAAK-GTITPSG----------VPGIQIDGFFP--DSSSFNGTHG 
149 9actn-a0a1h3plu7  14.2%  SDTVEVPGA--EAAVTACLPDLTTAGLLQAPP--------------------------------GEFTDRTDWISLHAP-GTSNPSG----------VPGLQVDGYFP--DTSTLNTTHG 
150 9actn-a0a1i7c0f4  13.5%  DDTVHVPGA--ELAVTACLPDITTAGLLQAPA--------------------------------GQYTDQADWLSLHAP-GTANPSG----------VPGLQVDGYFS--DSSTFNTTHG 
151 9actn-a0a239hpj8  13.1%  ADSVEVPGA--ERAETTCLPDITTAGLLTAPP--------------------------------GQYTDQADWLPLHAP-GTTNPSG----------VPGLQVDGYFP--DTSSFNTTHG 
152 9actn-a0a1i5tu93  13.4%  GDTVEVPGA--EHSVTACLPDLTTSGLQQQAP--------------------------------GRYTDVADWTGLHAL-GTQNPSG----------VPGLQVDGYFP--DTSTSNTLHG 
153 9actn-a0a1m5evl2  14.3%  DDTVEVPGA--ELSVTACLPDLTTAGLQAAAP--------------------------------GRYTDPADWTGLHMP-GTRNPTG----------VPGLQVDGYFP--DTSTTNTLHG 
    consensus/100%           ......................................................................st...h.....................l.G.p..sh.....tt....... 
    consensus/90%            .s.l...us....t.sss.s-LhTuGhstsu...................................hss.usauthhs.....s.tG..........lsG.ph.ua.s..Dso....... 
    consensus/80%            .shl...Gs..ttphsus.s-LhTAGhstoG...................................hossusauthhs....ss.pG..........lsGhph.uahs..Dso....... 
    consensus/70%            sshl...Gs..tpphsus.sDLhTAGhstoG...................................hossusautLhus..sssssG..........lsGhph.uYhs..DuS....... 

  1 ralso-hboh       100.0%  --------GQQNVVLLVQIPDAFDPANPCIITATSSGSRGIYGAIST-GEWGLKHKCAVAYTDKG-TGAGPHDLATDTVPLQDGTRTTRLAAGRTAQFAAPLTDSQLAAFNAATPNRLAF 
  2 ralpj-b2uat7      82.9%  --------GQQNVVLLVQIPDSFDVNNPCIITATSSGSRGIYGAIST-GEWGLKRKCAVAYTDKG-TGAGPHDLATDTVALQDGTRTTRSAAGSNAHFAAPLTSSQLAAFNSATPNRLAF 
  3 cupnh-hboh        58.9%  --------GQQNVTMLVQIPASFNTSKPCMITATSSGSRGVYGAIAT-GEWGLKRGCAVAYTDKG-TGAAPHDLDTDTVPLIDGTRATRAAAGKNAQFAAPAGATSLADFTAANPHRLAF 
  4 cuptr-b3r2m0      59.8%  --------GQQNVTMLVQIPASFNTARPCLITATSSGSRGVYGAIGT-GEWGLKRGCAVAYTDKG-TGAAPHDLDTDTVPLIDGTRTTRAAAGKNAHFAAPAGATALAEFTAANPHRLAF 
  5 cupnj-hboh        58.2%  --------GQENVTMLVQIPNTFNQSKPCMITATSSGSRGVYGAIAV-GEWGLKRGCAVAYTDKG-TGAAPHDLDTDTVPLIDGTRTTRSAAGTNAQFAARPGILSLADFTAQVPHRLAF 
  6 9burk-a0a0c4yad2  60.9%  --------GQQNVTMLVQIPDSFNVAKPCLITATSSGSRGVYGAIST-GEWALKRGCAVAYTDKG-TGAAPHDLDTDTVALIDGTRTSRAAAGANAQFAAPFPNTSLAAFNALAPHRLAF 
  7 9burk-a0a069i4i2  59.1%  --------GQQNVTMLVQIPDSFNVAKPCLITATSSGSRGVYGAIST-GEWALKRGCAVAYTDKG-TGAAPHDLDTDTVPLIDGTRANRTAAGTSAQFAAPFPNTSLAAFNALAPHRLAF 
  8 9burk-v2ivt7      59.4%  --------GRQNVTMMVQIPASFDPARPCLITATSSGSRGVYGGIST-GEWGLKRGCAVAYTDKG-TGAAPHDLANDTVALIDGTRTSRAAAGREAHFAAPIDDNARAAFIAAAPHRLAF 
  9 9burk-a0a1g6iei9  59.1%  --------GQQNVTLMAQIPNSFDPANPCLISATSSGSRGVYGGIAV-GEWGLKHGCAVAYTDKG-TGAAPHDLDTDTVPLIDGTRQTRSAAGKLAQFAAQPGAMSLADFTTANPHRLAF 
 10 9burk-a0a1i1cz09  58.7%  --------GQQNVTIMAQIPTNFDPANPCLISATSSGSRGIYGGISV-GEWGLKRGCAVAYTDKG-TGAGPHDLDSDTVPLINGTRQARTGAGKLAQFAAQPGAQSLADFTTANPHRLAY 
 11 9rals-a0a1h0kna3  57.2%  --------GTKNVTMMVQVPDSFDKSNPCVISATSSGSRGVYGGIAV-GEWGLKRGCAVAYTDKG-TGAAPHDLDTDTVPLIDGTRGDRRGVGKAAQFAAQPGAQSLADFTTANPHRLAF 
 12 aciac-hboh        58.7%  --------GRRNVTLMVQVPDAFDRTRPCIITATSSGSRGIYGGIPT-GEWGLKRGCAVAYTDKG-TGAAPHDLQADTVALIDGTRTSATLAGTRAAFDAGLSAADLAAFNGATPQRLAF 
 13 9burk-a0a1i1tgt8  58.2%  --------GRRNITLMVQVPDGFDRSRPCIVTATSSGSSGIYGGIST-GEWGLKRGCAVAYTDKG-TGTSPHDLQTDTVALVDGTRTTATLAGTRAAFNAGLSAADLAAFNAATPQRLAF 
 14 9burk-a0a0q4rum3  57.4%  --------GRKNVTLMVQVPTTFNPAKPCMITATTSGSRGVYGGIST-GEWGLKKGCAVAYSDKG-TGGAPHDLQNDTVPLIDGTRATAAAAGKNAAFNAGLTATELAAFNTATPNRFAF 
 15 9burk-a0a0q6zbr6  57.4%  --------GRKNVTLMVQVPASFDPKKPCMITATASGSRGVYGGIST-GEWGLKKGCAVAYSDKG-TGGAPHDLMNDTVPLLDGTRTTATAAGKAAAFNAGLTATELAAFNTATPNRFAF 
 16 9burk-k0i392      57.4%  --------GRKNVTLMVQVPASFDPKKPCMITATASGSRGVYGGIST-GEWGLKKGCAVAYSDKG-TGGAPHDLQNDTVPLMDGTRTTATAAGKAAAFNAGLTATELAAFNTATPNRFAF 
 17 9burk-a0a165i0t6  58.2%  --------GRKSVTLMVQVPASFDPKKPCMITATTSGSRGVYGGIST-GEWGLKKGCAVAYSDKG-TGGAPHDLQNDTVPLIDGTRTTAAAAGKAAAFNAGLTATELAAFNTATPNRFAF 
 18 9burk-h0bzn8      57.0%  --------GRKNVTLMVQVPASFDPKKPCMITATASGSRGVYGGIST-GEWGLKKGCAVAYSDKG-TGGAPHDLQNDTVPLIDGTRATAAAAGANAAFNAGLTPTELAAFNAGTPNRFAF 
 19 9burk-j1eg31      59.3%  --------GRQNVTLMVQVPDSFNPARPCMITATASGSRGVYGGIST-GEWGLKRGCAVAYSDKG-TGAAPHDLQNDTVPLIDGTRTTAAAAGKNAAFNANLTPAQLAAFNAATPNRFAF 
 20 comt2-d0j2k4      58.6%  --------GRKNVTLMVQVPDSFDPRKACIITATASGSRGVYGAITT-GEWGLKRGCAVAYSDKG-TGAAPYDLMNDTVPLIDGTRSTAAAAGKQAAFNAGLTAGELAAFNTATPNRFAF 
 21 9burk-a0a0q4y4j2  56.9%  --------GRQNVTLLVQVPSSFDPAKPCIVTATSSGSRGVYGALSA-GEWGLKRGCAVAYTDKG-TGAAPHDLQNDTVPLIDGRRASAATAGNAAAFRAALTPAELATFNAQTPNRFAF 
 22 9burk-a0a0s9ndl4  58.1%  --------GRRNVTLMVQVPNSFDAKQACIVTATSSGSRGVYGAISA-GEWALKRGCAVAYTDKG-TGAAPHDLQNDTVPLIDGTRAAASAAGTAAAFRAALTDSQRAAYNAATPNRFAF 
 23 9burk-a0a0u3d7f1  59.4%  --------GERNVSLMVQVPANFNPSQPCIITATSSGSRSIYGAIST-GEWGLKKGCAVAYTDKG-THSAGHDLATDTVPLLDGTRDSAAAAGKGAAFKAKLTAAELASFNAASPNRLAF 
 24 9burk-h5wj03      59.5%  --------GQQNVTLMVQVPASFNPRKPCIITATSSGSRGVYGAIST-GEWGLKRGCAVAYTDKG-TGSAPHDLATDTVPLIDGTRSTSAAAGTQAQFRAPLDAAQLAAVNAAMPNRLAF 
 25 rhoft-hboh        51.5%  --------GRQNITMMVQVPATFNPASPCIVTATSSGSRGVYGAIGSSGEWGLKNGCAVAYTDKG-TGTGIHDLQNDTVNVQNGGRASATAAGKASIFTALLTSIERAAFNLATPNRFAI 
 26 polna-hboh        52.1%  --------GRQNITMMVQVPASFNPANACIVTGTSSGSRGVYGAIGSAGEWGLKNGCAVAYTDKG-TGTGIHDLQNNTVNVQNGVRTDAAAAGKNSIFTAELSASERAAFNAATPNRFAV 
 27 polsj-hboh        52.3%  --------GNQNITMLVQVPTTFNPASPCIVTGTSSGSRGVYGAIGTSGEWGLKNGCAVAYTDKG-TGTGIHDLQNDTVNLQRGERATATAAGKASNFTASLTSTERAAFNTATPNRFAV 
 28 9burk-a0a1i7i9y5  51.5%  --------GRQNVTLMVQVPAGFNPASPCIVTGTSSGSRGIYGAIGSSGEWGLKNGCAVAYTDKG-TGSGMHDLQNNTVHLQNGLRADAGAAGTVSNFTAALSPAERTAFNAAWPYRFAV 
 29 9burk-j2kx41      51.7%  --------GRHNVTMMVQVPASFNPASACIVTGTSSGSRGVYGAIGSSGEWGLKNGCAVAYTDKG-TGSGMHDLQNNTVHLQNGLRADAVAAGMTSNFTAAISPAERTAFNAATPNRFAV 
 30 9burk-a0a1h3llv4  52.0%  --------GKQNVTMMVQIPNSFNPASPCIITGTSSGSRGVYGAVGTSGEWGLKHGCAVAYNDKG-TGNGIDDLQNNTVNLQDGVRSSVAAAGVNSNFTADVTDAQRTAFNAVTPKRFAV 
 31 9burk-a0a0q8qlw9  52.2%  --------GQVNVTLMVQIPAGFDKANPCIVTATSSGSRGVYGAIGTAGDWGLKQNCAVAYSDKG-SGMGFHNLQSNTVNMLNGERANAVAAGKNSSFTANLTAAELTAFNAATPNRFAI 
 32 9prot-a0a1p8fhr2  51.8%  --------GKLNVTLMVQIPSTFNPNSACIVTAASSGSRGVYGAMATAGEWGLKKGCAVAYTDKG-SGNGGHDQNANTAYGLQGQRGNAGTLGIQSIFTAAGTDAERAAFNTAFPNRWAY 
 33 9burk-a0a0m2wss7  46.6%  --------GKKNVTLMVQVPASFDPDHACIVTGTSSGSRGIYGAIGSSGEWGLKKGCAVAYADKG-SGTGLYVFEDDSVNLQNGLRAGRVAAGKNALFAPDLSDAERLAWAGSNPNRIAF 
 34 9burk-a0a255hvv2  47.0%  --------GKKNLTLMVQVPASFDPERACIVTGTSSGSRGIYGAIGSSGEWGLKKGCAVAYADKG-SGTGLYVFDDDSVNLQNGLRATRTQAGKNAIFAPDLLDADRAAFARDYPNRVAF 
 35 9burk-a0a1h8cn61  46.3%  --------GNQNVTLMVQVPAGFDVKNPCIVTGTSSGSRGIYGAIGSAGEWGLKNNCAVAYADKG-SGTGLYTFDDDSVNLQNGVRATRTAAGKNSSFTPALTDAERAAFAAAYPGRVAF 
 36 9burk-a0a0x8gl12  48.4%  --------GRQNVTLMVQIPASFNQSKPCVVTATSSGSRGVYGAVSAAGEWGLKHGCAVAYADKG-SGTGIHDLSSDTVNLIDGTRANRSFGG--GNFDAGLSGSELADFNAQFPNRIAS 
 37 9neis-a0a2g3jcr7  48.2%  --------GRQNVTLMVQIPASFNQSKPCVVTATSSGSRGVYGAVSAAGEWGLKHGCAVAYADKG-SGTGIHDLSSDTVNLIDGTRANRSFGG--GNFDAGLSGSELASFNTQFPYRIAS 
 38 9burk-a0a1k2h8v5  48.7%  --------GRQNVTLMVQIPASFDSSRPCVVTATSSGSRGVYGAISAAGEWGLKQGCAVAYADKG-SGLGVHDLANDTVNLIDGTRASRASAGTNANFSAALSDAELASFNAAFPNRIAL 
 39 9burk-a0a0c1yp15  50.4%  --------GRQNVVLMVQLPDTFNPAKPCIVTATSSGSRGIYGAIGTSGEWGLKHGCAVAYTDKG-SGNGFHDLQSNRVTLIDGTIADADAAGTDAHFRAPVSDTARTAYNAQYPNRVAY 
 40 rubgi-i0hxc6      49.4%  --------GLQNVTLMVQVPDRFDPARPCIVTATSSGSRGIYGAIGTAGEWGLKHGCAVAYTDKG-SGNGQHELGANLVTLRDGRVVDAASAGTEALFRAPLSDAEREALLAQAPYRVAY 
 41 lepcp-b1xzg8      46.9%  --------GRQNVTLMVQVPNHFDPARPCIVTATSSGSRGIYGAIGTAGEWGLKRGCAVAYTDKG-TGNGLHDPTSGLVMSRNGSTTTATVAGLESIFSLPDSLASLSTFVGSFANRVGF 
 42 azosb-hboh        50.0%  --------DDSKVTLMVQVPAHFNPKAPCIVTGTSSGSRGIYGAIGTSGEWGLQKGCAVAYADKG-TGNGMHDLDTNTVGLIDGTRADAVAAGVASHFTADLTEAERTQFLASWPHRVAV 
 43 9rhoo-h0pzw5      51.5%  --------ERGNVTLMVQVPAHFNPKKPCIVTATSSGSRGIYGAIGTSGEWGLQKGCAVAYADKG-TGNGMHDLATNTVGLIDGTRADAATAGDASHFTADLSESERAAFLAAWPNRVAV 
 44 parxl-hboh        50.4%  --------GTQNVTVLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELSSSLVTLIDGTLQNATAAGKASLFTANLGNTDLASYNSRFPNRYAF 
 45 9burk-a0a248vv48  49.9%  --------GTQNVTMLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-SGNGAHELSSNRVTLIDGTLQDAGAAGKASLFTANLGNTDLATYNSQFPNRYAF 
 46 9burk-a0a1m6k1z0  50.3%  --------GKQNVSMLVQIPASFNADQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-GGNGAHELSTNRVTLIDGTLADAGAAGKASLFTANLGNVDLATFNSQFPNRYAF 
 47 bursg-e1teq0      50.3%  --------GKQNVSVLVQIPASFNADQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELSTNRVTLIDGTLQDAGAAGKASLFTANLGNTDLATFNSQFPNRYAF 
 48 9burk-a0a1a9n382  49.8%  --------GTQNVSMLVQIPASFNPNQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELSTNRITLIDGTLQDATAAGKASLFTANLGNSNLTTFNSQFPNRYAF 
 49 9burk-a0a1n7rin1  50.8%  --------GAQNVSMLVQIPNSFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELSTNRVTLIDGTLQDAATAGKASLFTANLSGAALASFNIRFPNRYAF 
 50 9burk-a0a0q5pi68  50.8%  --------GKKNVSLLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELATNLVTLIDGTLANANGAGKTSEFTANPGATSIAAFNAQFSNRYAF 
 51 9burk-a0a158i436  50.2%  --------GKKNVSLLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELATDLITLIDGTLSGAAAAGKTSEFTANPGATSIAAFNAQFPNRYAF 
 52 9burk-a0a158f2z2  51.1%  --------GTLNVSLLVQIPASFNPGQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELATNTVTLIDGTLFNAAAAGKTSVFTANLGSTSLAAFNAQFPNRYAF 
 53 9burk-a0a069pj40  50.6%  --------GKQNVSLLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-TGNGAHELATNNVTLIDGTLINANAAGRTSIFTANLGQTSLSAFNTSFPNRYAF 
 54 9burk-a0a158fjp6  50.7%  --------GTKNVSLLVQIPTSFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELSTNLVTLIDGTLTGANLAGRGSIFTANLGSTSLSTFNTSFPNRYAF 
 55 9burk-a0a158i7p9  50.3%  --------GTKNVSLMVQIPASFNPDQPCIVTAASSGSRGVYGAISAAGEWGLKRGCAFAYTDKG-SGNGAHELATNLVTLIDGTLLGANAAGKTSIFTANLGSTSISAFNTNFPNRYAF 
 56 9burk-a0a158j083  49.8%  --------GTKNVSLLVQIPASFNPDHPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELATNIVTLIDGTLAGANAAGKSSVFTANLGSTSAATFNTNFANRYAF 
 57 9burk-a0a157ze58  50.8%  --------GTQNVSLLVQIPASFDPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-GGNGAHELATSLVTMIDGTLASTSLAGTKAIFKANASASDLASFNSAFPNRYAY 
 58 9burk-g8m711      49.8%  --------GTQNVSLLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-GGNGAHELATSLVTMIDGTLASTNLAGTKAIFKANVSASSLSSFNSAFPNRYAY 
 59 9burk-a0a158bp80  50.8%  --------GAQNVSLLVQVPTTFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAQEISTTLVTLIDGTLASAEIAGTKAIFKANVSASALSSFNAAFPNRYAY 
 60 9burk-r4wsp2      50.6%  --------GTQNVSLLVQIPASFNPDQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGGHELATNLVTLIDGTLANASLAGTKAIFKANVSASALSSFNSAFPNRYAF 
 61 9burk-a0a0a6qad6  49.5%  --------GRQNVSLLVQVPASFNPASPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELMTGTVTLIDGLTADAATAGRNSLFTANVPAAGLAAYNQQYPNRYAF 
 62 9burk-a0a1g7byt2  49.6%  --------GRQNVSLLVQVPASFDPANPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELMTGLVTLIDGRLADAATAGRASLFTANVPAGALAAYNQKYPDRYAF 
 63 parp8-b2jvh3      48.6%  --------GRRNVSLLVQVPAAFNPRSPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGANELMTGLVTLIDGRVADAATAGRSSLFTANVPADSLADYNQKYPYRYAF 
 64 9burk-a0a1q8iw17  47.0%  --------GRQNVSLLVQVPASFNPANACIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELMSGLVTLIDGRLANAAAAGHASLFTADVSASKLATYNQKYPYRYAF 
 65 9burk-b5wc15      47.5%  --------GRQNVSLLVQVPATFNPANPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELMSGLVTLIDGRLATAATAGPASLFTANVPATTLSAYNQNFPHRYAF 
 66 parcy-a0a1x7gjk2  49.5%  --------GRRNVTLLVQVPARFDPANPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAHELMTNRVTLIDGRVADAAAAGKDSLFTANISARARDAFDRAYPNRYAF 
 67 9burk-a0a1l6hzb8  50.5%  --------GLQNVTLLVQLPAGFDPANPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-TGNGAHELTTNLVTLIDGRLANANTAGTKSLFTANLPLSSLAIFNQTFPNRYAY 
 68 9burk-a0a142ywf2  50.5%  --------GKQNVTLMVQVPGTFDPNNPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGAEEMQTGLVTLMNGTLSTAAGAGTASLFTANVSSANLTSFNTGFPNRYAF 
 69 burvg-hboh        50.5%  --------GRKNVTLLVQVPASFDPAQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-GGNGAQELGSNTVTLIDGTLANAVLAGSASLFTANLTSGDLAAFNSRFPNRYAF 
 70 9burk-b1t7h7      50.2%  --------GRKNVTLLVQVPASFDPAQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-GGNGAHELGSDTITLIDGTLANAVLAGNASLFTANVTSGDLAAFNSRFPNRYAF 
 71 burm1-a0a0h3kh69  51.2%  --------GRKNVTLLVQVPASFNPAQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-GGNGAHELGSDTVTLIDGTLANAVLAGNASLFTANLTSGDLAAFNSRFPNRYAF 
 72 9burk-u2gbn1      50.5%  --------GSKNVTLLVQVPASFNPAQPCIVTATSSGSRGVYGAISAAGEWALKRGCAVAYNDKG-GGNGAHELMSDTVTLIDGTLANAVLAGTASLFTANVTSGDLATFNSRFPNRYAF 
 73 burcj-b4ecv6      51.1%  --------GTKNVTLLVQVPARFDPAQPCIVTATSSGSRGVYGAISAAGEWALKRGCAVAYNDKG-GGNGAHELGSDTVTLIDGTLANAVLAGTASLFTANVTSGDLAAFNSRFPNRYAF 
 74 9burk-a0a119uvu7  50.3%  --------GRRNVTLLVQVPTGFDPTQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKG-GGNGAHELGSDTVTLIDGTLANAVLAGNASLFTANVSSGELAAYNAQFPNRYAF 
 75 burps-hboh        49.8%  --------GRKNVTLLVQVPASFDPANPCIVTATASGSRGVYGAIAAAGEWGLKRGCAVAYNDKG-GGNGAHEIGTGVVTLIDGTLATASSAGSSSLFTASESSSTLAAFNSAFPNRYAY 
 76 9burk-a0a0d5lcs9  50.0%  --------GRKNVTLLVQVPASFDPANPCIVTATASGSRGVYGAIAAAGEWGLKRGCAVAYNDKG-GGNGAHEIGTGLVTLIDGTLANASSAGSASLFTASESSNMLAAFNSAFPNRYAY 
 77 9burk-a0a103ehy2  49.7%  --------GRKNVTLLVQVPASFDPANPCIVTATSSGSRGVYGAIATAGEWGLKRGCAVAYNDKG-GGNGAHEIGTNRITRIDGTLADASSAGHASLFTASEPGSALAAFNSAYPYRYAY 
 78 9prot-a0a0n1b5s2  52.4%  --------GRVNVVVMAQIPASFDPANPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKG-SGNGGHELATGIVTFFDGTLGTAASLGAGSHFTANVLPADLAAFNAANPFRYAF 
 79 9burk-a0a059kik8  53.0%  --------GRDNVGVMVQVPASFNPDAPCIVAAPSSGSRGIYGAIGTTGEWGLKRGCAVAYTDKG-TGSGAHELSTDTVIRLDGTTASATAAGSTAHFNAGLSTAERTAVNTTRPNRYAF 
 80 marhv-hboh        41.3%  ---------TVPVTVMAQVPDSFDPDFPCMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-TGTGAHNLATNTAQSVNGTLTMEPEE---ALFRADLDAQSRDDFNSQWPDRFAW 
 81 9alte-a0a1i6h326  43.4%  ---------EVPVTVMAQVPDSFDPEQPCMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-TGTGAHNLATNTAQRIDGTLTDAAEP---VQFRADLSEEERASFNAAWPDRFAW 
 82 9alte-a0a2g1vdq6  41.9%  ---------DVPVTVMAQVPESFDPEQPCMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-TGTGSHNLATNTAQRIDGTLTSSEEP---VQFRADLTDEQRATFDSAWPDRFAW 
 83 9alte-a0a0p8apl5  43.1%  ---------DVPVTVMVQVPDSFDPAEACMITAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-TGTGSHNLATNAAQRIDGTLTRGDEP---VQFRADLDDQTRADFNADWPDRFAY 
 84 9alte-a6f5e1      41.9%  ---------DVPVTVMVQVPSSFDPKQACMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-TGTGSHNLATNSAQRIDGTLTQADGP---VQFRADLDAQARADFDAAWPDRFAY 
 85 9alte-a0a072mx50  42.9%  ---------NQPVTVMAQVPDTFDDDRPCMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-TGTGSHNLETGAAQRLDGSLTSADEP---VQFRADLTESELADFNAATPDHFAW 
 86 9alte-r8b0j8      41.3%  ---------TVPVTAMVQVPDSFDPRRPCMVTAPSSGSRGVYGAIGTAGEWGLKKGCAVVYTDKG-TGTGAHNLVTNSTQRIDGTLTTTDDES--VLFRASLDDAARADFNSQWPDRFAY 
 87 9alte-n6wvv7      44.2%  ---------EVPVTVMVQIPDSYDPAASCMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVYTDKG-SGTGSFNMETGAAQDMRGQLTTNENVD--VQFESDLEASERATFNSNWPDRFAF 
 88 9prot-a0a0d2sri5  44.6%  -----------GVTIMVQVPDSFGIGQTCIVTAPSSGSRGVYGAIATAGEWGLKRGCAVAYTDKG-TGIGVHDLSADTVGLVTGERVPAGSSPDRVNFRAGLDGAARTAFNAAFPNRLAW 
 89 9prot-w9h9a9      43.6%  IASWTQEWGGERVTLMVQVPDGFAMGQACIVTAPSSGSRGVYGAIATAGEWGLKRGCAVAYTDKG-TGMGVHDLDRDTVNLITGERVSASAQPDRVNFRADLSEPERAAFAAAFPHRLAW 
 90 9chlr-a0a2h3l7f5  45.0%  --------GAQNVTMMVQIPTTFDPQNACLVTAPSSGSRGVYGAIGGVGEWALKRGCAVAYTDKG-TGMGYHDLTAGTVNLLTGERSTVADAGLNANFVATFDQ----DWATANPNRIAV 
 91 causk-b0t3v3      39.4%  -V----------SAMLLQTPRSLSRTQRCIVAVPVAGSFSLYHDINTLGYWGLQHGCAVVYTDKG-HGDGVHDLDTDTVNLIDGTRAAAKVAGKASHFTADLSEARRRVFVKQWPHRIAF 
 92 strhy-FKBW        12.7%  --------WNHDAQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGPAFYR---------DGSRPGDAVA---------------------------- 
 93 9actn-a0a0g3avt9  14.1%  --------WNHDSQFVIRLPDHFNGG---LVVAGTPGNREQYANDKAISDWVLARGYAYAATDKGNTGTAFYR---------DGRRPGDAIA---------------------------- 
 94 9actn-a0a1d7ykt0  13.2%  --------WNHDSQFVIRLPDRWNGG---LVVAGTPGNRQQYANDKAISDWVLARGYAYAATDKGNTGTAFYR---------DGHRPADAIA---------------------------- 
 95 9actn-a0a101p6p6  13.8%  --------WNHDSQFVVRLPDHWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGTAFYR---------DGPRPGDAIA---------------------------- 
 96 strrc-v6jsq5      13.0%  --------WHHDAQFVIRLPDHWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGTAFYR---------DGRRPGDAIA---------------------------- 
 97 9actn-a0a0j8alc0  13.6%  --------WHHDSQFVIRLPDHWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGTAFYR---------DGRRPGDAIA---------------------------- 
 98 strhj-h2jv72      14.1%  --------WQHDSQFVIRLPDHWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGTAFYR---------DGRRPGDAIA---------------------------- 
 99 9actn-a0a1q5kj90  14.1%  --------WQHDSQFVVRLPDHWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGTAFHR---------DGRRPGDAIA---------------------------- 
100 9actn-a0a1q5jti2  13.3%  --------WNHDAQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGLAFHR---------DGRRPGDAVA---------------------------- 
101 9actn-a0a170yun5  12.8%  --------WNHDAQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGPAFHR---------DGSRPGDAVA---------------------------- 
102 strvd-d5zzz8      13.5%  --------WNHDAQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGLDFHR---------DGSRPGDAVA---------------------------- 
103 9actn-d9xmy1      12.8%  --------WNHDSQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGLAFHQ---------DGSRPGDAVV---------------------------- 
104 9actn-a0a1v6msd3  13.9%  --------WNHDAQFVVRLPDRWNGG---LVVAGTPGNREQYANDRAVADWVLARGYAYAATDKGNTGLAFHR---------DGSRPGDAVA---------------------------- 
105 9actn-a0a231pik6  14.5%  --------WRHDAQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLSRGYAYAATDKGNTGLAFHR---------DGRRPGDAIA---------------------------- 
106 9actn-a0a243s7n5  14.0%  --------WGHDAQFVVRLPDRWNGG---LVVAGTPGNREQYANDRAVADWVLSRGYAYAATDKGNTGLAFYR---------DGRMPGDAIA---------------------------- 
107 strvt-d9x4g9      13.6%  --------WRHDAQFVIRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLSRGYAYAATDKGNTGLAFHR---------DGKTPGDAIA---------------------------- 
108 strga-a0a089wz13  13.5%  --------WNHDAQFVLRLPDRWNGG---LVVAGTPGNREQYANDRAIADWVLARGYAYAATDKGNTGLAFHR---------DGGAPGDAIA---------------------------- 
109 stra4-a0a0b5em56  13.8%  --------WNHDSQFVIRLPDRWNGG---LVVSGTPGNREQYANDRAIADWVLSRGYAFAATDKGNTGAAFHR---------DGRRPGDAVA---------------------------- 
110 9actn-a0a1b9f0r1  13.8%  --------WNHDSQFVIRLPDRWNGG---LVVAGSPGVREQYANDRAFGDWALDRGYAFAATDKGNTSAAFHR---------DGRAPGDAIA---------------------------- 
111 9actn-v6u5a7      13.4%  --------WNHDSQFVIRLPDRWNGG---LVVAGSPGVREQYANDRAFGDWAVARGYAFAATDKGNTSAAFHR---------DGRAPGDAIA---------------------------- 
112 strgg-b1vv39      13.8%  --------WNHDSQFVIRLPDRWNGG---LVVAGSPGVREQYANDRAFGDWALARGYAYAATDKGNTSAAFHR---------DGAAPADAIA---------------------------- 
113 strnv-v6jhg3      13.0%  --------WNHDAQFVIRLPDRWNGG---LVIAGSPGVRKQYANDRAFGDWVLARGYAYAATDKGNTGADFHR---------DGAAPGDALA---------------------------- 
114 9actn-a0a1z1w3d1  15.0%  --------WDHDAQFVIRLPDRWNGG---LVVAGTPGNRAQYANDRAIGDWVLARGYAYAATDKGNTGAGFHR---------DGRRPADAVA---------------------------- 
115 9actn-a0a0c1vxf7  14.1%  --------WNHDAQFVIRLPDHWNGG---LVVTGSPGVRAQYANDRAIGDWVLARGYAFAATDKGNTGVTFYR---------DGRAPGDAIS---------------------------- 
116 9actn-a0a1e7kkk9  14.4%  --------WRHDSQFVIRLPHDWNGG---LVVTGSSGNREQYANDRAIGDWALARGYAFAATDKGNTGAKFYR---------DGDRPGDAIA---------------------------- 
117 9actn-a0a1d7vlb5  13.5%  --------WQHDAQFVIRLPDRWNGG---LVISGSPGTRKQYANDRAIGDWVLARGYAFAATDKGNTGTDFYR---------DGTAPGDAVA---------------------------- 
118 9actn-a0a1c6lyy5  14.1%  --------WAHDSQFVLRLPARWNGG---LVVTGSPGNREQYANDRAIGDWALKRGYAFAATDKGNTGTGFHR---------DGRRPGDAVV---------------------------- 
119 9actn-a0a1c6nj41  14.4%  --------WQHDSQFVLRLPARWNGG---LVVSGAPGNREQYANDRAIGDWVLGRGYAFAATDKGNTGAAFHR---------DGRTPGDAVA---------------------------- 
120 9actn-a0a1e7jip1  13.6%  --------WGHDAQFVLRLPARWNGG---LVVSGAPGNREQYANDRAIGDWALKRGYAFAATDKGNTGAAFHR---------DGRTPGDAVV---------------------------- 
121 9actn-a0a1e7kw84  14.4%  --------WAHDAQFVLRLPARWNGG---LVVSGSPGNREQYANDRAIGDWALARGYAFAATDKGNTGADFHR---------DGRTPGDAVA---------------------------- 
122 9pseu-i0v4y5      13.9%  --------WNHDSQFVIRLPRDWNGG---LVVSGTPGNREQYANDRVISDWVLSKGYAFAATDKGNTGLGFHT---------DGRRPGDAVA---------------------------- 
123 9actn-v6knz8      12.5%  --------WNHDAQFVIRLPDDWNGG---LVVTGAPGVRAQYANDRAIADHVLARGYAFASTDKGNVGGTFHE---------DGRRPGDAVA---------------------------- 
124 9pseu-a0a1h5qih7  14.1%  --------WNHDSQFVLRLPAHWNGG---LVVSGSPGVRRQYANDRAIGDQALAEGYAFAATDKGNTGAAFYD---------DGVRPGDALA---------------------------- 
125 9pseu-r1i3m0      14.3%  --------WNHDAQFVLRLPDRWNGG---LVVSGSPGVRRQYANDRAIGDQALAEGYAFAATDKGNTGAAFYT---------DGVRPGDALA---------------------------- 
126 9pseu-a0a1q9lh88  13.4%  --------WAHDSQFVLRLPERWNGG---LVVSGSPGTRRQYANDRAISDHALAAGYAFAATDKGNTGLAFYT---------DGTRPGDALV---------------------------- 
127 9actn-a0a1n6wgk4  14.5%  --------WNHDAQFVIRLPQHWNGG---LVVAGSPGNRETYANDFTISDWALAKGYAYAATDKGNTGVEFYR---------DGVRPGDAVA---------------------------- 
128 9mico-a0a0a0jbp0  13.5%  --------WNHDSQFVIRIPDNWNGG---LVVTGAPGNRTQYANDQVWSDFVLGQGYAFASTDKGNVGLNFWD---------DGSEPGGSVA---------------------------- 
129 9mico-a0a0a0jwc4  13.5%  --------WNHDSQFVIRIPDDWNGG---LVVTGAPGNRSQYANDFVWSDYVLAQGFAFASTDKGNMGTKFYD---------DGSSPGGSVR---------------------------- 
130 9mico-a3tg58      12.9%  --------WNHDSQFVLRIPDNWNGG---LVITGAPGNRTQYANDFVWSDWVLAQGYAFASTDKGNMGLKFYD---------DGSEPGGSVR---------------------------- 
131 9mico-a0a0q9lt59  15.3%  --------WNHDAQFVLRIPDHWNGG---LVVSGAPGVRAQYANDFIISDWVLSKGYAFASTDKGNTGASFYD---------DGSSPGGSIR---------------------------- 
132 9mico-a0a0t2ikk7  13.4%  --------WNHDSQFVLRLPDHWNGG---LVVSGAPGTRAQYANDFIISDWVLSKGYAFASTDKGNTGAAFYR---------DDSAPGGSIR---------------------------- 
133 9actn-a0a239adt9  13.2%  --------WNHDAQFVIRLPERWNGG---LVVAGPPGNRRQYANDFTISDWALAKGYAYAATDKGNSGTEFSK---------DGRRPGDAVV---------------------------- 
134 9actn-a0a1i5y3q1  13.5%  --------WNHDSQFVIRLPKRWNGG---LVVSGAPGTRRQYANDFTISDWVLSKGYAFASTDKGSNGNQFYR---------DGKRPGDAVA---------------------------- 
135 9actn-a0a239p629  14.0%  --------WNHDSQFVIRLPERWNGG---LVVSGAPGTRLQYANDFTISDWVLAKGYAFASTDKGNNGPTFFQ---------DGRRPGDAIA---------------------------- 
136 9actn-a0a0c5g9u7  13.7%  --------WRHDAQFVIRLPDRWNGG---LVVTGAPGTRRQYATDKAISDRVLAQGYAYAATDKGNNGADFHR---------DGQRPGDAVA---------------------------- 
137 9actn-a0a086n6p2  13.5%  --------WRHDAQFVIRLPDHWNGG---LVVTGAPGTRKQYATDKAISDRVLAQGYAYAATDKGNSGTAFYR---------DGIRPGDAIA---------------------------- 
138 9actn-a0a1q5luf4  12.8%  --------WRHDAQFVIRLPDRWNGG---LVVTGAPGNRKQYATDKAISDQVLARGYAYAATDKGNSGVDFYR---------DGRRPGDAVA---------------------------- 
139 strto-a0a081xqk7  12.2%  --------WAHDAQFVIRLPDRWNGG---LVVTGAPGTRKQYATDKAISDQVLAQGYAYAATDKGNNGVDFYR---------DGKRPGDAVA---------------------------- 
140 9actn-a0a124f0u4  13.0%  --------WNHDAQFVIRLPDHWNGG---LVVTGAPGTRRQYATDTAISDRVLAQGYAYAATDKGNSGADFYR---------DGNRPGDAVD---------------------------- 
141 9actn-a0a1e5p2p5  12.5%  --------WRHDAQFVIRMPERWNGG---LVVTGAPGTRRQYATDALISDHVLAQGYAYAATDKGNSGPDFYK---------DGRRPGDAVA---------------------------- 
142 9actn-a0a1q5j3v0  13.0%  --------WAHDAQFVIRLPDRWNGG---LVVTGAPGTRRQYSTDALISDQVLAQGFAYAATDKGNTGPDFFT---------DGRGPGDAVA---------------------------- 
143 9actn-a0a239d1v8  13.3%  --------WRHDAQFVLRLPDRWNGG---LIVTGAPGTRKQYSLDVLISDWAIARGYAFASTDKGNSGPDFYT---------DGRRPGDAMA---------------------------- 
144 9actn-a0a0n1fwk5  11.6%  --------WNHDSQFVIRLPERWNGG---LVVTGAPGTRKQYSLDPLISDWVIAQGYAFASIDKGNSGPDFYT---------DGKRPGDAIA---------------------------- 
145 9actn-a0a1c5chu9  12.7%  --------WKHDAQFVIRLPDRWNGG---LVVTGAPGTRKQYSLDPLISDWVLAQGYAFASTDKGNSGPDFYT---------DGTRPGDAVV---------------------------- 
146 strfr-a0a081en77  12.2%  --------WDHDAQFVIRLPERWNGG---LVVTGAPGLRKQYSLDPLISDWVLDRGYAFASTDKGNSGPDFYT---------DGVRPGDAVA---------------------------- 
147 9actn-a0a1g8xy87  12.5%  --------WNHDAQFVIRLPERWNGK---LVVTGAPGVRKQYALDVLISDWVLAQGYAFAATDKGNSGPDFYT---------DGRRPGDAVA---------------------------- 
148 9actn-a0a0x3szz0  12.2%  --------WRHDAQFVIRLPDRWNGG---LVVTGAPGTRKQYATDAVVSDRVLAQGYAYAATDKGNSGADFYT---------DGSRPGDAIA---------------------------- 
149 9actn-a0a1h3plu7  14.2%  --------WNHDSQFVLLLPDAWNGG---LVVTGAPGVRKQYACDFLISDFVLARGFAYACTDKGNNGPDFFR---------DGDRPGDAVA---------------------------- 
150 9actn-a0a1i7c0f4  13.5%  --------WNHDSQFVLRIPDDWNGG---LVVTGAPGNRKQYANDFLMSDFVLAQGFAFASTDKGNNSPDFYR---------DGEQPADAVA---------------------------- 
151 9actn-a0a239hpj8  13.1%  --------WDHDSQFVLRIPDDWNGG---LVVTGAPGNRKQYASDFLFSDSVVAQGFAYASTDKGNNSPDFYL---------DGEQPADAVA---------------------------- 
152 9actn-a0a1i5tu93  13.4%  --------WNHDSQFVLRIPDDWNGG---LVVAGAPGTRKQYASDFLVSDAVLAQGFAYASTDKGNNGVDFYR---------DGVAPGDAVA---------------------------- 
153 9actn-a0a1m5evl2  14.3%  --------WDHDSQFVLRIPDDWNGG---LVVSGAPGTRKQYASDFLISDFVLAQGFAYASTDKGNNGVDFYR---------DGVAPGDAVM---------------------------- 
    consensus/100%           ..............hhh.hPtths.t...hl.ssssG....Yt.....u..slttthAhs..DKG..t.t............ps.................................... 
    consensus/90%            ........hppssphhlplPspasst...hlsssssGsRt.Yus..s.u-asLtpGhAhA.sDKG.sG.s.ap.........sG.hssts.s............................ 
    consensus/80%            ........hppssphhlplPspasss...lVsususGsRt.Yus.ts.u-WsLt+GhAhAhTDKG.oGsshac.........DGphsssshA............................ 
    consensus/70%            ........hppssphhlplPspassu...lVsusosGoRt.Yus.tshu-WsLt+GhAhAhTDKG.oGsuhac.........DGptsssuhA............................ 

  1 ralso-hboh       100.0%  KHAHSQRNPEKDWGLFTLQAVQFAFWAIN--DKL-G-AA-GMP------A-GSPLPVRRDNTIVIASSISNGGGAAIAAAEQ---------DTAGWI----DGVAV----GEPGLNLPPS 
  2 ralpj-b2uat7      82.9%  KHAHSQRNPEKDWGLFTLQAVQFAFWAIN--DKIAG-TS-GAL------V-GSALPVRPDNTIVIASSISNGGGAAIAAAEQ---------DTGGWI----DGVAV----GEPGLNLPPN 
  3 cupnh-hboh        58.9%  KHAHSQRNPEKDWGKFTLQAVEFAIWAIN--DRF-G-AV-SAN------G-TRQRTLDKDRIVVIASSVSNGGGAAVAAAEQ---------DAGGLI----DGVAV----GEPNLNMPPN 
  4 cuptr-b3r2m0      59.8%  KHAHSQRNPEKDWGKFTLQAVEFALWAIN--DRF-G-AV-SAN------G-TRQRTLGQDKVLVIASSVSNGGGAAVAAAEQ---------DAGGLI----DGVAV----AEPNLNMPPN 
  5 cupnj-hboh        58.2%  KHAHSQRNPEKDWGKFTLQAIEFGIWAIN--DRF-G-TV-ASN------G-VRQRTLAKSKIVVIASSVSNGGGAAVAAAEQ---------DTDGLI----DGVAV----AEPNLNLPPN 
  6 9burk-a0a0c4yad2  60.9%  KHAHSQRNPEKDWGTFTLQAASFAIWAIN--DRF-G-NV-ATD------G-TRQRSLGPDKVVVIASSVSNGGGAAIAAAEQ---------DTQGLI----DGVAV----AEPNLNLPSN 
  7 9burk-a0a069i4i2  59.1%  KHAHSQRNPEKDWGTFTLQAAEFAIWAIN--DRF-G-TV-ASD------G-TRQRSFGPDKIVVIASSVSNGGGAAVAAAEQ---------DTQGLI----DGVAV----AEPNLNLPAN 
  8 9burk-v2ivt7      59.4%  KHAHSQRNPEKDWGLFTLQAIEFGLWAIN--DRH-G-EM--RD------G-QRRRTIDKDKLLVIASSLSNGGGAAVAAAEA---------DVQGLI----DGVAV----SEPNLNMPQD 
  9 9burk-a0a1g6iei9  59.1%  KHAHSKQNPEANWGQNTLQAIEFAIFAIN--DKF-G-AT-SIN------G-TRQASLTKDKILVIASAVSNGGGAAIAAAEQ---------DTTGLI----DGVAV----GEPNVNLPPT 
 10 9burk-a0a1i1cz09  58.7%  KHAHSKQNPEANWGLNTLQAIEFAMWAIN--DKF-G-TV-GSD------G-VRQASIGKDKILVIASAVSNGGGAAIAAAEQ---------DTNGLI----DGVAV----GEPNVNMPAV 
 11 9rals-a0a1h0kna3  57.2%  KHAHSQQNPEADWGKNTLQAIQFALFAIN--DRF-G-TM-GAD------G-VRQATFTKNNVLVIASAISNGGGAAVAAAEQ---------DTDGLI----DGVAV----GEPNVEMPPS 
 12 aciac-hboh        58.7%  KHAHSGQNPEKDWGLSTLQAVEFAFYVLN--ERF-G-DR-SPG------G-QALRTFTPANTTVIASSLSNGGGAAIAAAEQ---------DTRGLI----DGVAV----SEPSVQMPAN 
 13 9burk-a0a1i1tgt8  58.2%  KHAHSGQNPEKDWGSATLQAVEFAFYVIN--ERF-G-DR-SPG------G-QPLRSFQPSNTTVIASSLSNGGGAAIAAAEL---------DTQGLI----DGVAV----SEPSVQLPAN 
 14 9burk-a0a0q4rum3  57.4%  KHAHSGQNSEKDWGTTTLQAVEFGYYVLN--QRY-G-NT-DAA------G-QRLKTLTPANTIVIASSISNGGGAAIAAAEQ---------DTQGLI----SGVAV----SEPALELPAN 
 15 9burk-a0a0q6zbr6  57.4%  KHAHSGQNAEKDWGTTTLQAVEFGYYVLN--QRY-G-AT-DAA------G-QRLKTLTPANTIVIASSISNGGGSAIAAAEL---------DTQGLI----SGVAV----SEPAIEMPAN 
 16 9burk-k0i392      57.4%  KHAHSGQNSEKDWGTTTLQAVEFGYYVLN--QRY-G-AT-DAA------G-QRLKTLTPANTIVIASSISNGGGSAIAAAEL---------DTQGLI----SGVAV----SEPAIEMPAN 
 17 9burk-a0a165i0t6  58.2%  KHAHSGQNSEKDWGTSTLQAVEFGYYVLN--QRY-G-AT-DAA------G-QRLKTLTPANTIVIASSISNGGGAAIAAAEL---------DTQGLI----SGVAV----SEPAIEMPAN 
 18 9burk-h0bzn8      57.0%  KHAHSGQNAEKDWGTTTLQAVEFGYYVLN--QRY-G-ET-NAA------G-QRLKSLTPANTIVIASSISNGGGSAIAAAEQ---------DTQGLI----SGVAV----SEPAIEMPAN 
 19 9burk-j1eg31      59.3%  KHAHSGQNAEKDWGTTTLQAVEFGYYVLN--ERY-G-SL-TVS------G-QRIKSLTPGNTIVIASSISNGGGAAIAAAEL---------DTQGLI----SGVAV----SEPAVELPAN 
 20 comt2-d0j2k4      58.6%  KHAHSGQNPEKDWGRTTLQAVEFAYYVLN--ERY-G-ER-NIL------G-ERLRTLKPSNTIVIASSISNGGGAAITAAEQ---------DSQGLI----NGVAV----SEPAVELPAS 
 21 9burk-a0a0q4y4j2  56.9%  KHAHSQQNPEKDWGKSTLQAVQFAFYVLN--ERL-G-KL-SDT--------TRLQTFARGNTIVIASSASNGGGSALAAAEL---------DTEGWI----DGVAV----SEPAVELPAD 
 22 9burk-a0a0s9ndl4  58.1%  KHAHSQQNPEKDWGRSTLQAVQFAFYVLN--ERL-G-ER-AAD------G-TRLQTFVRGNTLVIASSISNGGGAALAAAEL---------DDEGWI----DAVAV----SEPAVELPAD 
 23 9burk-a0a0u3d7f1  59.4%  KHAHSQRNPEKDWGLFTLQAVQLAFYVLN--ERY-G-ED-SGN------G-FKWTTITPGNTLVIASSLSNGGGAAVAAAEQ---------DSAGLI----DGVAV----SEPAVELPAN 
 24 9burk-h5wj03      59.5%  KHAHSQRNPERDWGRFTLQAVEFAFYALN--QQF-N-TL-AADDDEHDDDSRRARRIRPGNTLVIASSVSNGGGAAIAAAEL---------DREGLI----DGVAV----AEPAVEMPAA 
 25 rhoft-hboh        51.5%  KHAHSQQNPEKDWGKWTLQSVEFAYFVLN--QKY-G-DL-ASD------GVAHLKKLTPANTIVIASSVSNGAGAALAAAEQ---------DTQGLI----SGVAV----AEPEVQLAPD 
 26 polna-hboh        52.1%  KHAHSQQNPEKDWGKWTLQSVEFAYFVLN--EKY-G-DL-ARD------GATHLKKLTPSNTIVIASSVSNGAGAALAAAEQ---------DTQGLI----SGVAV----AEPEVQLAPD 
 27 polsj-hboh        52.3%  KHAHSQQNTEKDWGKWTLQAVEFAYFVLN--ENY-G-DA-AKD------GVSRLVKLKPANTIVIASSASNGAGAALAAAEL---------DTKGLI----TGVAV----AEPQIQVVPD 
 28 9burk-a0a1i7i9y5  51.5%  KHAHSQQNSEKDWGRFTLQSVEFAYFVLN--ERY-G-KP-SRD------GGARLRTLNPSNTIVIASSVSNGAGAALAAAEL---------DTQGLI----SGVAV----GEPQIQLVPD 
 29 9burk-j2kx41      51.7%  KHAHSQQNSEKDWGRFTLQAVEFAYYVLN--ERY-G-AP-ARD------GVSRLRTLTPANTIVIASSVSNGAGAALAAAEL---------DTRGLI----SGVAV----GEPQVQLVPD 
 30 9burk-a0a1h3llv4  52.0%  KHAHSQRNPEKDWGKFTLQSIEFAYYVLN--QKY-G-DV-AKD------GQSHLIKLSPANTIVIASSISNGAGAALAAAEQ---------DSKGLI----SGVAV----SEPHVQLAPD 
 31 9burk-a0a0q8qlw9  52.2%  KQAHSQQNSEKDWGKYTLQAVEFAFYALN--DKF-G-DV-ARN------GTSRLNTITPAKTLVIASSASNGGGAAILAAEQ---------DTKGLI----DGVAV----SEPVTEVALS 
 32 9prot-a0a1p8fhr2  51.8%  KHAHSQQNPEKDWGLNTIQAVRFALYVIN--EKY-G-PL---------DNGTRQATINRDNTLVIASSVSNGAGAAIAALEQ---------DTDGYI----DGLAV----AEPQVQLNAP 
 33 9burk-a0a0m2wss7  46.6%  KHAHSQQNPEKDWGKVTLQAVEMAYYVLN--ERY-G-VL-ARD------GSSRIVRLTPKNTITIASSISNGAGSALLAAEQ---------DSKGLI----SGVAA----SEPQVQPAAS 
 34 9burk-a0a255hvv2  47.0%  KHAHSQQNPEKDWGRATLQAVEFAYYVLN--ERY-G-AT-ARD------GVAHLVRLKPSNTITIASSISNGAGAALLAAEQ---------DTQGLI----SGVAA----SEPQIQPQPS 
 35 9burk-a0a1h8cn61  46.3%  KHAHSQQNPERDWGKVTLQAVEFAFYVLN--EKY-G-TL-AKD------NKSHLIALSPKNTITIASSISNGAGAALLAAEQ---------DSKGLI----SGVAA----SEPQIQPKA- 
 36 9burk-a0a0x8gl12  48.4%  KHAHSQQNPEKDWGRDTLRAVEFAFWLLN--EKY-A----SAQ-----VGLRKADYATPATVTVIAASASNGGGAALAAAEQ---------DTRGLI----DGVAV----SEPQVQPASV 
 37 9neis-a0a2g3jcr7  48.2%  KHAHSQQNPEKDWGRDTLRAVEFAFWLLN--EKY-A----TVQ-----AGLRKADYAMPSTVTVIAASASNGGGAALAAAEQ---------DTKGLI----DGVAV----SEPQVQPASV 
 38 9burk-a0a1k2h8v5  48.7%  KHAHSQQNSEKDWGQATLRAVEFAFYLLN--EKYAA----AAD-----GGGKRADYATPARVTVIAASVSNGGGAALAAAEQ---------DSRGLI----DGVAV----GEPQAQPKDV 
 39 9burk-a0a0c1yp15  50.4%  KHAHSQQNPEMDWGKNTLQAIEFAFYVLN--EQY-G----TRN------GAVKARAIVPANTLVIASSVSNGGGAAVAAAEQ---------DKHGLI----DAVVV----SEPNVQPKDN 
 40 rubgi-i0hxc6      49.4%  KHAHSKQNPEADWGRHTLEAVRFAFWVLN--ERY-G-KV-GRD------G-RREATLQPRNTIVIASSVSNGGGAALAAAEQ---------DREGLI----DGVAV----SEPNAQPRWM 
 41 lepcp-b1xzg8      46.9%  KHAHSQQNPEKDWGRNTLDAVRLAFYVLN--ERY-G-AVSTTD------PTKRQQTFKASNTLVIASSVSNGGGAALAAAEQ---------DTEGLI----DGIAV----SEPNAQPGSN 
 42 azosb-hboh        50.0%  KHAHSRANPEAHWGQDTLDAVRFAFFVLN--ETY-G----RRT------PRGIVRTILPPNTVVIASSVSNGGGAALAAAEQ---------DDERLI----DGVAV----GEPQIQLREN 
 43 9rhoo-h0pzw5      51.5%  KHAHSKLNPEADWGRDTLDAVRFAFYVLN--EKY-G----VHT------PQGVVRTIVKQKTVVIAASVSNGAGAALAAAEQ---------DDEDLI----DGVAV----GEPQIQLREN 
 44 parxl-hboh        50.4%  KHAHSQQNPEKDWGRNTLQAIQFAYWALN--DSY-G-TL---N------GSTRNVRYTSGSITTIAASVSNGGGASLAAAEQ---------DTSGLI----TAVVV----GEPQINLRLP 
 45 9burk-a0a248vv48  49.9%  KHAHSQQNPEQDWGKNTLQAIQFAYWALN--DSY-G-TL---N------GTTRNVRYTSGSIMTIAASVSNGGGASLAAAEQ---------DTSGWI----TAVVV----GEPQINLRLP 
 46 9burk-a0a1m6k1z0  50.3%  KHAHSQQNPEQDWGKNTLQAIQFAYWALN--DSY-G-PL---N------GSAHTVRYASGSITTIAASVSNGGGASLAAAEQ---------DTSGLI----TAVVV----GEPQINLRLP 
 47 bursg-e1teq0      50.3%  KHAHSQQNPEQDWGKNTLQAIQFAYWALN--DSY-G-TL---N------GTTRTVRYKPGGILTIAASVSNGGGAALAAAEQ---------DTSGLI----NAVVV----GEPQINVRVP 
 48 9burk-a0a1a9n382  49.8%  KHAHSQQNPEKDWGTDTLEAIQFAYWALN--DSY-G-AL---N------GSTRTVRYASGSITTIAASVSNGGGASLAAAEQ---------DTSGLI----TAVVV----GEPQINLRLS 
 49 9burk-a0a1n7rin1  50.8%  KHAHSQQNPEQDWGKDTLEAIQFAYWALN--DSF-G-AL---N------GSTRTVRYTSGSITTIAASVSNGGGASLAAAEQ---------DTSGLI----TAVVV----GEPQINLRLS 
 50 9burk-a0a0q5pi68  50.8%  KHAHSQQNPEKDWGTNTLQAIQFAYWALN--DTY-G-AV---D------GSNHKTRYNRGDITTIAASVSNGGGASLAAAEQ---------DTQGWI----TAVVV----GEPQINLRVP 
 51 9burk-a0a158i436  50.2%  KHAHSQQNPEKDWGTNTLQAIQFAYWALN--DTY-G-SL---D------GTTRKTRYNRGDVTTIAASVSNGGGASLAAAEQ---------DTQGWI----TAVVV----GEPQINLKVP 
 52 9burk-a0a158f2z2  51.1%  KHAHSQQNPEKSWGTNTLQAIQFAYWALN--DTY-G-SL---D------GSTRKIRYNRGDVTTIAASVSNGGGASLAAAEQ---------DTQGWI----TAVVV----GEPQINLNVP 
 53 9burk-a0a069pj40  50.6%  KHAHSQQNPEKDWGTNTLEAIQFAYWALN--DTY-G-TL---D------GTTRKVRYSKGSVTTIASSVSNGGGAAIAAAEQ---------DKDGWI----TAVVV----GEPQINLNLP 
 54 9burk-a0a158fjp6  50.7%  KHAHSQQNPEKDWGTNTLQAIQFAYWALN--DSY-G-PL---D------GTTRKVRYTKGSVTTIAASVSNGGGASLAAAEQ---------DTDGWI----TAVVV----GEPQINLNLP 
 55 9burk-a0a158i7p9  50.3%  KHAHSQQNPEKDWGNNTLQAIQFAYWALN--DSY-G-TL---D------GTTRKVRYGKGSVTTIAASVSNGGGAALAAAEQ---------DSDGWI----TAVVV----GEPQINFTLP 
 56 9burk-a0a158j083  49.8%  KHAHSQQNPEKDWGNNTLQAIQFAYWALN--DSY-G-TL---D------GTTRQVRYGRGSITTIAASVSNGGGASLAAAEQ---------DTDGWI----TAVVV----GEPQINLNLP 
 57 9burk-a0a157ze58  50.8%  KHAHSQQNPEASWGKNTLQAIQFAYWALN--DMF-G-PV---S------GSTRQVRYNKGDITTIAASVSNGGGASLAAAEQ---------DTDGWI----TAVVV----GEPQINLNLP 
 58 9burk-g8m711      49.8%  KHAHSQQNPEASWGKNTLQAIQFAYWALN--DMF-G-PI---S------GSTHQVRYNKGGITTIASSVSNGGGAALAAAEQ---------DTDGWI----TAVVV----GEPQINLNLP 
 59 9burk-a0a158bp80  50.8%  KHAHSQQNPEKDWGKNTLQAIQFAYWALN--DMF-G-PV---N------GSTHQVRYNKGDITTIAASVSNGGGASLAAAEQ---------DTDGWI----TAVVV----GEPQINLNLP 
 60 9burk-r4wsp2      50.6%  KHAHSQQNPEKDWGKNTLQAIQFAYWALN--DMF-G-AV---S------GSSHQVRYGKGSITTIAASVSNGGGASLAAAEQ---------DTDGWI----TAVVV----GEPQINLNLP 
 61 9burk-a0a0a6qad6  49.5%  KHAHSQQNPEQDWGKDTLEAVQFAYWVLN--QQF-A-PS-ADTS---NTASNHGVRYAPGDITTIAASVSNGGGASLAAAEQ---------DPGKWI----TAVVV----GEPQINVRMP 
 62 9burk-a0a1g7byt2  49.6%  KHAHSQQNPEADWGKDTLEAVQFAYWVLN--QQF-A-RR-VD-------AANHGVRYAPGDITTIAASVSNGGGAALAAAEQ---------DTGKWI----TAVVV----GEPQINVRMP 
 63 parp8-b2jvh3      48.6%  KHAHSQQNPEADWGRDTLAAIQFAYWALN--QQF-G-PR-IG-------ASAAGVRYEAGDITTIAASVSNGGGASLAAAEQ---------DTRGWI----TAVVV----GEPQINVRLP 
 64 9burk-a0a1q8iw17  47.0%  KHAHSQQNPEQDWGRDTLDAIQFAYWVLN--QQF-T-PR-AD-------SLHHRVRYQPGSITTIAASVSNGGGASLAAAEQ---------DTKGWI----TAVVV----GEPQINVRMP 
 65 9burk-b5wc15      47.5%  KHAHSQQNPEQDWGKDTLEAIQFAYWVLN--QQF-T-SL-VD-------SSHHRVQYQPGSITTIAASVSNGGGASLAAAEQ---------DTKGWI----TAVVV----GEPQINVRMP 
 66 parcy-a0a1x7gjk2  49.5%  KHAHSQQNPEAQWGKDTLRAIQFAYWVLN--RQF-P-PA-AV-------SARERVRYRPGSITTIAASVSNGGGASLAAAEE---------DRRGWI----TGVVV----GEPQVSVRMP 
 67 9burk-a0a1l6hzb8  50.5%  KHAHSQQNPEQDWGKDTLEAIQFAYWVLN--QQF-A-PM-VD-------DRNHGVRYRTGSITTIAASVSNGGGASLAAAEQ---------DTQGWI----TAVVV----GEPQINLNMS 
 68 9burk-a0a142ywf2  50.5%  KHAHSQQNPEQDWGHDTLEAIQFAYWALN--QQF-A-PT-VNN-----NAQQHGVRYSAGSITTIAASVSNGGGASLAAAEQ---------DTQGWI----TAVVV----GEPQINLNMA 
 69 burvg-hboh        50.5%  KHAHSQQNPEHDWGRATLQSVEFAYWALN--QQF-A-PL-VD-------GSHRGVRYRAGDITTIAASVSNGGGAALAAAEQ---------DTRRWI----TAVVV----GEPQINVRMA 
 70 9burk-b1t7h7      50.2%  KHAHSQQNPEQDWGHATLQAVEFAYWALN--EQF-G-PV-LD-------SSHHGVRYHPGDITTIAASVSNGGGAALAAAEQ---------DTRRWI----TAVVV----GEPQVNVRMA 
 71 burm1-a0a0h3kh69  51.2%  KHAHSQQNPEQDWGRSTLQAVEFAYWALN--EQF-A-PL-VD-------GSHRGVRYRAGDITTIAASVSNGGGASLAAAEQ---------DDRGWI----TAVVV----GEPQINVRLA 
 72 9burk-u2gbn1      50.5%  KHAHSQQNPEQDWGRVTLQSVEFAYWALN--EQF-G-PL-ID-------SSHHGVRYRAGDITTIAASVSNGGGASLAAAEQ---------DSRGWI----TAVVV----GEPQINVRMA 
 73 burcj-b4ecv6      51.1%  KHAHSQQNPEQDWGRATLQSVEFAYWALN--EQF-G-PV-ID-------GTHHGVRYRAGDITTIAASVSNGGGASLAAAEQ---------DSRGWI----TAVVV----GEPQINVRMA 
 74 9burk-a0a119uvu7  50.3%  KHAHSQQNPEQDWGRVTLQAVEFAYWALN--EQF-G-PL-ID-------GTRHGVRYRPGDITTIAASVSNGGGAALAAAEQ---------DTRNWI----TAVVV----GEPQVNVRLA 
 75 burps-hboh        49.8%  KHAHSQQNPEQDWGRVTLQAVEFAYWALN--EQF-G-PV-VD-------GTRHGIRYRPGDITTIAASVSNGGGSALAAAEQ---------DTRGWI----TAVVV----GEPQINVRMT 
 76 9burk-a0a0d5lcs9  50.0%  KHAHSQQNPEQDWGRVTLQAVEFAYWALN--EQF-G-PV-VD-------ITQHGIRYRPGDITTIAASVSNGGGSALAAAEQ---------DTRGWI----TAVVV----GEPQINVRLT 
 77 9burk-a0a103ehy2  49.7%  KHAHSQQNPEQDWGRVTLQAVEFAYWALN--EQY-G-PR-IG-------DRHHGIRYRPGDITTIAASVSNGGGAALAAAEQ---------DTRGWI----TAVVV----GEPQINVRLA 
 78 9prot-a0a0n1b5s2  52.4%  KHAHSQQNPEKDWGRNTLQTIEFTLWALN--EEY-G-PV--------SSSGVRGVRITPANTTVIAAGVSNGGGAALAAAEQ---------DAGGLI----DAVVV----GEPQINLRLP 
 79 9burk-a0a059kik8  53.0%  KHAHSQRNPEKDWGLWTLRSIQTAFWLLN--ETYAGLDA----------KDRRKVRLRPDNTLVIAASVSNGGGAVLAAAEQ---------DSGGLI----DGIVA----TEPQVSLPAN 
 80 marhv-hboh        41.3%  KHAHSKQNPEADWGRHVLQSIEFGFYMLN--TLH-GREL---------GNGETLRTINPRNTLVIASSVSNGGGASVRAAEQ---------DEKGLI----DGVAV----SEPNVNPAVD 
 81 9alte-a0a1i6h326  43.4%  KHAHSKVNPEADWGRHVLQSIEFGFYVLN--EKF-GKEL---------GNGATLRTIHPKNTVVIASSVSNGGGSSVRAAEL---------DTEGLI----DGVAV----SEPNVNPEVD 
 82 9alte-a0a2g1vdq6  41.9%  KHAHSKANPEADWGLHVLQSIEFGFYVLN--EKF-GREL---------GNGEILRTINPKNTVVIASSVSNGGGSSVRAAEL---------DTEGLI----DGVAV----SEPNVNPEVD 
 83 9alte-a0a0p8apl5  43.1%  KHAHSKANPEADWGRHVLQSIEFGFYILN--EKF-GQET---------GNGRKVVKVKPKNTLVIASSVSNGGGASVRAAEL---------DDSGLI----DGVAV----SEPNVNPQVD 
 84 9alte-a6f5e1      41.9%  KHAHSKANPEADWGRHVLQSIEFGFYVLN--EEF-GQET---------GNGRKVIKVKPKDTLVIASSVSNGGGASVRAAEL---------DDKGLI----DGVAV----SEPNVNPQVD 
 85 9alte-a0a072mx50  42.9%  KHAHSKANPEADWGQHVLQSIEFGFYALN--EQF-GQEL---------GNGERRITITPKNTLVIASSVSNGGGSSLRAAEQ---------DQHGLI----DGVAV----SEPNVNPMVD 
 86 9alte-r8b0j8      41.3%  KHAHSGVNPEADWGTHVLQSIEFGFYVLN--EKY-GREL---------GNGERLMTIKPRNTLVIASSVSNGGGASVRAAEQ---------DDRGLI----DGVAV----SEPNINPQVD 
 87 9alte-n6wvv7      44.2%  KHAHSKTNPEADWGQYVLASIEFGFYILN--ERF-GEET---------DDGDRLVTVTPENTLVIASSVSNGGGASVRAAEQ---------DEDGLI----DGVAV----SEPNVNPTVN 
 88 9prot-a0a0d2sri5  44.6%  KHAHSGGNPESRWGRDVLDSIELAFAILN--IHH---------------PGPNGRRHVPANTVVIASSVSNGGGASLRATET---------DLSGLI----DGVAV----SEPNVNPIHD 
 89 9prot-w9h9a9      43.6%  KHAHSRDNPESHWGQDVLNSIELAFAVLN--RYH---------------AAPNGRKYTPENTVVIASSVSNGGGASLRAAEE---------DRGNLI----DGVAV----SEPNVQPRFD 
 90 9chlr-a0a2h3l7f5  45.0%  KHAHSQQNPEADWGLHVLQSIEFAFYILNLPENY-G----TDD------GGTNRRALVTDNTLVIAAGVSNGGGASLRAAEL---------DTEGWI----DGVAV----SEPNVNPTQR 
 91 causk-b0t3v3      39.4%  KASHSKRNPESRWGEDVLNAIRFAFWRLN-----------ADD-----GGG-----WTPANTLVIVTGASNGGGATLYAGEA---------DTDGLI----DAVVA----AEPQVQLRPD 
 92 strhy-FKBW        12.7%  -----------EWNTRLTQLTRAARASVA--QRY-HRPL-ER---------------------TLVTGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-EG---------PNLFTFLP 
 93 9actn-a0a0g3avt9  14.1%  -----------EWNTRLTQLTRAARAVVA--QRY-HRPP-VR---------------------TIATGLSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-GG---------PHLLTFLP 
 94 9actn-a0a1d7ykt0  13.2%  -----------EWNTRLTQLTRAARAVTT--QRY-HRPP-TR---------------------TIATGLSNGGYLVRWQLEHHPELYDGGVDWEGTLWRT-DG---------PNPLTFLP 
 95 9actn-a0a101p6p6  13.8%  -----------EWNTRLTQLTRAARAVVA--QRY-HRPP-AR---------------------TIATGLSNGGYLVRWQLEHHPELYDGGVDWEGTLWRT-DG---------PDPLTFLP 
 96 strrc-v6jsq5      13.0%  -----------EWNTRLTQLTRAARAVVA--QRY-HRPP-AR---------------------TIATGLSNGGYLVRWQLEHHPELYDGGVDWEGTLWRT-AG---------PNPLTFLP 
 97 9actn-a0a0j8alc0  13.6%  -----------EWNSRLTQLTRAARTIVT--QRY-HQPP-TR---------------------TLATGMSNGGYLVRWQLEHHPELYDGGVDWEGTLWRT-DG---------PNLLTFLP 
 98 strhj-h2jv72      14.1%  -----------EWNTRLTQLTRAARAVVT--QRY-HRPP-AR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRT-DG---------PNLLTFLP 
 99 9actn-a0a1q5kj90  14.1%  -----------EWNTRLTQLTRAARAVVA--QRY-HRPP-AR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-DG---------PNLLTSLP 
100 9actn-a0a1q5jti2  13.3%  -----------EWNTRVTQLTRAARAVVA--QRY-HRPP-AR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRS-EG---------PNLFTFLP 
101 9actn-a0a170yun5  12.8%  -----------EWNTRLTQLTRAARAVVA--QRY-HRPP-AR---------------------TLVTGMSNGGYLVRWQLENHPELYDGGVDWEGTLWHA-QG---------PNLFTFLP 
102 strvd-d5zzz8      13.5%  -----------EWNTRLTQLTRAARSVVA--QRY-HRPP-AR---------------------TLVTGMSNGGYLVRWQLENHPELYDGGVDWEGTLWHS-EG---------PNLFTFLP 
103 9actn-d9xmy1      12.8%  -----------EWNNRVTQLTRAARAVVA--QRY-HRPP-TR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWDA-KG---------PNLFTFLP 
104 9actn-a0a1v6msd3  13.9%  -----------EWNTRLTQLTRAARTVVA--QRY-HRPP-AR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-EG---------PNLFTFLP 
105 9actn-a0a231pik6  14.5%  -----------EWNDRLTQLTRAARATVA--RHY-HRPP-AR---------------------TLVTGVSNGGYLVRWQLENHPELYDGGVDWEGTLWRS-DG---------PTLLDFLP 
106 9actn-a0a243s7n5  14.0%  -----------EWNDRLTQLTRAARATVA--RRY-DRPP-SR---------------------TVVTGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRS-DG---------PTLLDFLP 
107 strvt-d9x4g9      13.6%  -----------EWNDRLTQLTRAARATVA--RHY-HRPP-SH---------------------TLVTGMSNGGYLVRWQLENHPGLYDGGVDWEGTLWRS-DG---------PTLLDFLP 
108 strga-a0a089wz13  13.5%  -----------EWNHRLTQLTRAARAAVA--RRY-LRPP-SR---------------------TLVTGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-DG---------PTLLHFLP 
109 stra4-a0a0b5em56  13.8%  -----------EWNHRLTQLTRATKALTT--QRY-GRPP-SR---------------------TLATGLSNGGYLVRWQLENHPELYDGGVDWEGTLWRV-EG---------PNLLGFLP 
110 9actn-a0a1b9f0r1  13.8%  -----------EWNTRFTQLTRAARLVVA--QRY-LRPP-SR---------------------TLAMGMSNGGYLVRWQLENHPGLYDGGVDWEGALWRA-EG---------PNLLTFLP 
111 9actn-v6u5a7      13.4%  -----------EWNTRFTQLTRAARLVVA--QRY-LRPP-SR---------------------TLAMGMSNGGYLVRWQLENHPGLYDGGVDWEGALWRA-DG---------PNLLTFLP 
112 strgg-b1vv39      13.8%  -----------EWNTRVTQLTRAARRVVA--QRY-HRPP-SR---------------------TLAMGLSNGGYLVRWQLENHPGLYDGGVDWEGALWRS-EG---------PNLLTFLP 
113 strnv-v6jhg3      13.0%  -----------EWNTRVTQLARAAREVTT--QRY-QRPV-SR---------------------TLAMGMSNGGYLVRWQLENNPELYDGGVDWEGTLWRT-KD---------PNPLTFLP 
114 9actn-a0a1z1w3d1  15.0%  -----------EWNRRVTQLTRAARAVTA--QRY-GRPA-AR---------------------TLATGISNGGYLVRWQLENHPELYDGGVDWEGTLWRA-DG---------PNPLTSLP 
115 9actn-a0a0c1vxf7  14.1%  -----------EWNARVTQLSRAARAVVA--QRY-LRPP-SR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRE-QG---------PNLLTFLP 
116 9actn-a0a1e7kkk9  14.4%  -----------EWNTRFTQLTRAARAVIA--QRY-GRPP-AR---------------------TLATGLSNGGYLVRWQLENRPELYDGGVDWEGTLWRG-DG---------PNLLTFLP 
117 9actn-a0a1d7vlb5  13.5%  -----------EWNQRVTQLTRAARAVTA--QRY-RRPP-AR---------------------TLVTGLSNGGYLVRWQLENHPELYDGGVDWEGTLWRP-QG---------PNLLTFLP 
118 9actn-a0a1c6lyy5  14.1%  -----------EWNRRVTQLTRAARETVA--RHY-RRPP-AR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-DG-------KGPNLLTFLP 
119 9actn-a0a1c6nj41  14.4%  -----------EWNRRVTQLTRAARATVA--DHY-RRAP-AR---------------------TLATGMSNGGYLVRWQLENRPELYDGGVDWEGTLWRA-GG-------ERPNLLTFLP 
120 9actn-a0a1e7jip1  13.6%  -----------EWNQRVTQLTRAARATVA--HHY-RQPP-SR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-GG-------EPPGLLTFLP 
121 9actn-a0a1e7kw84  14.4%  -----------EWNERVTQLTRAARATVT--SHY-RHAP-AR---------------------TLATGMSNGGYLVRWQLENHPELYDGGVDWEGTLWRA-GG-------EQPNLLTFLP 
122 9pseu-i0v4y5      13.9%  -----------EWNHRVTQLARAAKATVA--QHY-RRPP-SR---------------------TVATGLSNGGYLVRWQLENHPELYDGGVDWEGTLWSE-EG---------PNLVEYLP 
123 9actn-v6knz8      12.5%  -----------EWNRRVTQLTRAARTVVD--RRY-HRPP-DR---------------------TLAAGQSNGGYLVRWQLENRPRLYDGGVDWEGTLWRA-DGRGPRRSGQGPNLFTFLP 
124 9pseu-a0a1h5qih7  14.1%  -----------EWNTRVTQLTLAARAAAV--AHY-RRPV-TR---------------------TLAAGLSNGGYLVRWQLENRPWLYDGGVDWEGTLWRA-DG---------PNLLTFLP 
125 9pseu-r1i3m0      14.3%  -----------EWNSRVTQLTLAARAAAA--RHY-GRPV-AK---------------------TLAAGLSNGGYLVRWQLENRPWLYDGGVDWEGTLWRA-DG---------PNLLTFLP 
126 9pseu-a0a1q9lh88  13.4%  -----------EWNDRVTQLTVAAKAAVA--HHY-GTLP-RR---------------------TLAAGLSNGGYLVRWQLENRPWLYDGGVDWEGTLWTT-RG---------PNLLTFLP 
127 9actn-a0a1n6wgk4  14.5%  -----------EWNRRVSELAVAAKTVVR--QRY-GRPA-RT---------------------TIAAGQSNGGYLVRWQIENRPDLFDGGVDWEGTLFTA-DG---------PNLLTFLP 
128 9mico-a0a0a0jbp0  13.5%  -----------EWHSRVTELTIASKKVLQ--KVK-AKKP-SR---------------------TWMAGISNGGYLVRWQLENRPDLYDGGLDWEGTLLRG-DG---------PNLLTYLP 
129 9mico-a0a0a0jwc4  13.5%  -----------EWNSRVTELTLAAKRVVK--QVR-AKAP-QR---------------------TWMAGISNGGYLVRWQLENRPDLYDGGLDWEGTLLRA-DG---------PNLLTYLP 
130 9mico-a3tg58      12.9%  -----------EWNSRVTQLTLAAKRVVK--QVR-AKSP-QH---------------------TWMAGLSNGGYLVRWQLENRPDLYDGGLDWEGTLLRA-DG---------PNLLTYLP 
131 9mico-a0a0q9lt59  15.3%  -----------EWNSRVTELTLASKTTLR--QVY-AKAP-SR---------------------TWMVGISNGGYLTRWQLENRPDLYDGGVDWEGTLFRA-AG---------PNLFTYLP 
132 9mico-a0a0t2ikk7  13.4%  -----------EWNSRVTQLTVAAKSTLR--KVY-AKSP-KR---------------------TWMVGISNGGYLTRWQLENRPDLYDGGVDWEGTLFRA-EG---------PNLLTYLP 
133 9actn-a0a239adt9  13.2%  -----------EWNDRVTQLTRAAKKVVA--KRY-GRAP-RR---------------------TYAAGISNGGYLVRWQLENRPELYDGGIDAEGTLWRT-DG---------PNLFTYLP 
134 9actn-a0a1i5y3q1  13.5%  -----------EWYRRMIQVTVAAKATVA--RHY-GRRL-TR---------------------TYAAGISNGGQMVRWALENHPELYDGGVDSEGTYWPR-DN--------GNNALVYLP 
135 9actn-a0a239p629  14.0%  -----------EWYRRMTQLTVAAKATVA--RHY-GRPL-RR---------------------TYAAGISNGGQLVRKALEDHPELYDGGLDSEGTYWPR-DG--------GNNALVYLP 
136 9actn-a0a0c5g9u7  13.7%  -----------EWNTRTTELTRAARRVVA--QRY-GQAP-LR---------------------TYITGISNGGYLTRWQLENHPELYDGGVDWEGALWTV-RG---------PSLLTSLP 
137 9actn-a0a086n6p2  13.5%  -----------EWNARTTQLTRAVRQVAA--QRY-GHAP-RR---------------------TYIAGISNGGYLTRWQLETHPELYDGGVDWEGALWTA-NG---------PSLLTSLP 
138 9actn-a0a1q5luf4  12.8%  -----------EWNARTTQLTRAARRAVA--QRY-GHAP-RR---------------------TYVTGVSNGGYLTRWQLENHPELYDGGVDWEGTLWAA-EG---------RHPLLSLP 
139 strto-a0a081xqk7  12.2%  -----------EWNARTTQLTRAARRAVA--QRY-GHAP-RR---------------------TYMTGVSNGGYLTRWQLENHPELYDGGVDWEGTLWAG-EG---------RHPLHSLP 
140 9actn-a0a124f0u4  13.0%  -----------EWNRRTTQLTLAAKRVVA--AHY-GRAP-RR---------------------TYMTGISNGGYLTRWQLEHRPELYDGGVDWEGALWTA-EG---------PNLLTSLP 
141 9actn-a0a1e5p2p5  12.5%  -----------EWNRRTTELTRAARRTLA--QWY-GHAP-RR---------------------TYMTGISNGGYLTRWQLENHPGLYDGGVDWEGALWTA-DG---------GGLLGSLP 
142 9actn-a0a1q5j3v0  13.0%  -----------EWNRRVTELTRGAKRAVR--QRY-GHAP-ER---------------------TYMTGISNGGYLTRWQLENRPELYDGGVDWEGALWTA-RD---------PQLLTSLP 
143 9actn-a0a239d1v8  13.3%  -----------EWNRRTTQLTVAAKAAVA--SRY-GRAP-HR---------------------TYMTGISNGGYLTRWQLEHHPALYDGGVDWEGTLWTA-DG---------PNLLTSLP 
144 9actn-a0a0n1fwk5  11.6%  -----------EWNRRTTELTLATKTVVR--QAY-GHAP-RR---------------------TYMTGISNGGYLTRWQLENHPELYDGGVDWEGALWTE-DG---------PNLFTYLP 
145 9actn-a0a1c5chu9  12.7%  -----------EWNRRTTELTRAAKKAVQ--RAY-GHAP-RR---------------------TYMTGTSNGGYLTRWQLENHPELYDGGVDWEGVLWTE-RG---------PNLLTYLP 
146 strfr-a0a081en77  12.2%  -----------EWHDRTTELTRAARTVVK--QAY-GRAP-RR---------------------TYMTGISNGGYLTRWQLENHPGLYDAGLDWEGALWTP-DG---------PNLFTYLP 
147 9actn-a0a1g8xy87  12.5%  -----------EWHRRTTELTRAAKGVLR--QAY-GKAP-AR---------------------TYMTGISNGGYLTRWQLENHPELYDGGVDWEGTLFTA-DG---------PNMFSSLP 
148 9actn-a0a0x3szz0  12.2%  -----------EWNRRTTELTRAAKAVAA--RRY-GRAP-HR---------------------TYITGVSNGGYLTRWQLEHHPRLYDGGVDWEGVLWAAGGG---------PNPLRTLP 
149 9actn-a0a1h3plu7  14.2%  -----------EWHERVTQLTIAAQGALQ--ERF-GSAP-QR---------------------TYLAGISNGGYLVRWQLENHPELYDGGVDWEGTLFTP-DG---------PNLFTYLP 
150 9actn-a0a1i7c0f4  13.5%  -----------EWHDRVTQLAVAAQSALR--ERY-GSAP-DR---------------------TYVAGISNGGYLVRWQLENRPELYDGGVDWEGTLFTP-DG---------PNLFTYLP 
151 9actn-a0a239hpj8  13.1%  -----------EWHDRVTQLAVAARGALK--ERY-GHAP-ER---------------------TYMAGISNGGYLVRWQLENRPELYDGGVDWEGTLFTP-DG---------PNLFTYLP 
152 9actn-a0a1i5tu93  13.4%  -----------EWHQRVTELAVAAKATLR--QHL-GQAP-QR---------------------TYVAGISNGGYLVRWQLENRAHLYDGGVDWEGTLFTP-DG---------PNLFTYLP 
153 9actn-a0a1m5evl2  14.3%  -----------EWHDRVTQLAVAAKGAIR--EHL-GRAP-ER---------------------TYMAGISNGGYLVRWQLENRAHLYDGGVDWEGTLFTP-DG---------PNLFTYLP 
    consensus/100%           ...........pW...h.t...hs...h...................................shh.u.SNGu..shhthE..........D.tthh....ts................. 
    consensus/90%            ...........-Wsp.hhp.h.huhhslt..pta.t...........................shhsuhSNGGhhshhthE..........D.pGhl....pu.........Ptl....s 
    consensus/80%            ...........-WsptshphhphAhhsls..ppa.t.s.........................slssulSNGGhhshhthEp.........DhpGhl....su.........Ppl.h.hs 
    consensus/70%            ...........-WsppshQhsphAhhsls..ppa.u.s...t.....................slAsulSNGGhhshhthEp.........DhcGhl....sG.........Ppl.h.hs 

  1 ralso-hboh       100.0%  ANV----QVARGG--VTLPVSGKPLFDYVSYANLFRLCAASSSGVSA-AP-TQAFFAGAVGWPASVQANRCAALRANGLLSSATAAAQADEALQKLHA-FGWEPESDLVHASMSYFEIDP 
  2 ralpj-b2uat7      82.9%  TGV----QVVRGG--TTLPTTGKPLFDYVSYANVFRLCAASSASVAT-AP-AQAFFTSLTTFPAGVQANRCAALKAAGLLTSTTAAAQADEALQKMRT-YGWEPESDLVHASMSFYEIDP 
  3 cupnh-hboh        58.9%  TGI----VVQRGA--TPVAASGRTLYDYTTTANLLQHCAARATALTQ-AP----FYTNPAT--ATFFANRCQTLAEKGLVSGANTDEQSASALQALHD-AGWEAESDDLHPSLAVFDVAA 
  4 cuptr-b3r2m0      59.8%  TGI----VVRRGA--SQVAASGLTLYDYTTTANLLQHCAGRATALTQ-AP----FYANPTM--APFFAARCQTLAEKGLVTGANTDQQSASALQALRA-AGWEAESDDLHPSLAAFDVAA 
  5 cupnj-hboh        58.2%  ASI----LVKRGS--KPVNASGRLLYDYITTANLLQLCASQATALVN-AP----AF---AT--NQFYISRCQTLVDNKLISGTTVSDQAASALDQLHL-AGWEPESDALHPSLSLFDTAA 
  6 9burk-a0a0c4yad2  60.9%  TGV----TVTRGG--VPVSLSGRPLYDYTTTANLLQLCTSQATALVN-APG-VALYALPTVGLAQPALNRCQSLANAGLVTGPDAASQAASALQALHA-FGWEAESDALHPSLALFEVAN 
  7 9burk-a0a069i4i2  59.1%  TGV----IVTRGG--VPVSKSGLVLYDYTTTANLMQLCTSQATALVN-APG-VALYALPAVGLVQPALNRCQSLANAGLVTGADGASRAADALQKLHD-AGWESDSDALHPSLALFEVAS 
  8 9burk-v2ivt7      59.4%  AGI----TVRRGG--TPVAVNGRTLYDYTTMANLLQLCAAQDPANAQ-APA-VGFY---AT-LGTIPTNRCAALASAGIIKGATLAEQAANAQQALRD-YGWEPESAVLHASLGFFEVSS 
  9 9burk-a0a1g6iei9  59.1%  AGI----TVKRGG--VQVAASGKHLYDYTTTANLLSLCASQVTLP---VPF--------AAGVAPQGGNRCAALASAGKVTGGTIAAQSADALAKLHL-AGWEPESDVLHASLSSLEVAS 
 10 9burk-a0a1i1cz09  58.7%  PAI----TVKRGG--VTVGSSGRHLYDYTTTANLFSLCAGQKVLP---APF--------TPSPALQGGNRCASLVGGGQLAGADLIARADDALDHLHA-AGWEPESDVLHASLSTFEVAS 
 11 9rals-a0a1h0kna3  57.2%  PVI----TVRRGG--TQVAASGKHLYDYTTTANLFQLCASQDPTLVN-APL--------AAAPGTFGVNRCTSLNGKGKVTGATAGDRGTSALAALHA-AGWETESDELHSSLSALEVAS 
 12 aciac-hboh        58.7%  AGV----TVQRGG--RTVAVNGLPLIDYTTQAHLYQACAALAPSLAS-TPFAAAFAVRFADPAFPVAANRCAGLKARGLLSAATTAAQAEEALARLTA-YGWEPESGALHASLAAFEVAP 
 13 9burk-a0a1i1tgt8  58.2%  AGV----TVQRGG--RTVAVNGRPLIDYVTQAHLYQSCAALAPSLAS-TPFAATFAIRFADPAFPAAANRCAGLRAQGLLTATSTNAQAEEALARLVS-YGWEPESGALHASLAAFEVAP 
 14 9burk-a0a0q4rum3  57.4%  PGV----TVRRGS--TTVAVTGKTLVDFTTYANLYQACASLAASVST-SPYAAAYAAGFASAALPIAPNRCAALKTAGLLSASATATQAEEALQRLRD-YGWEPESNDLHASLAAFEVAP 
 15 9burk-a0a0q6zbr6  57.4%  PGV----TVRRGS--ADVAVTGKTLVDFTTYANLYQACASLAPSVST-SPYAAAFAAGFGSAALPIAPNRCASLKTAGLLTASTTATQAEEALQKLRA-YGWEPESNDLHASLAAFEVAP 
 16 9burk-k0i392      57.4%  PGV----TVRRGS--AEVAVTGKTLVDFTTYANLYQACASLAPSVST-SPYAAAFAAGFGSAALPIAPNRCASLKAAGLLTASTTATQAEEALQKLRA-YGWEPESNDLHASLAAFEVAP 
 17 9burk-a0a165i0t6  58.2%  PGV----TVRRGS--ADVAVTGKTLVDFTTYANLYQACASLAPSVST-SPFAAAFAAGFASTALPIAPNRCASLKAAGLLTASTTATQAEEALQKLRA-YGWEPESSDLHASMAAFEVSP 
 18 9burk-h0bzn8      57.0%  PGV----TVRRGS--ADIVVTGKPLIDFTTYANLYQSCASLAPSIGS-TPYAAAFAAGFGSAALPIAPNRCASLKAAGLLSASTTATQAEEALQKLRD-YGWEPESNDLHASLAAFEVAP 
 19 9burk-j1eg31      59.3%  PGV----TVQRGS--TQIAVTGRPLIDYTTQANLYQACASLAPSVST-SPYAAAFAAGFAGTALPIAPGRCAALRARGLLTADTTAGQAEESLRKLRD-YGWEPESNDLHASLAAFEVAP 
 20 comt2-d0j2k4      58.6%  PGV----TVRRGG--TALPVVGKTLVDFTSYANLYQSCASLAASVSG-SPYAAAFAEGFASTALPIAPNRCAALRTAGLLNATTTAAQAEEALQKLRD-YGWEPESSELHASLAAFEVAP 
 21 9burk-a0a0q4y4j2  56.9%  PGV----SIRRGA--NAIPVSARTLIDFTTYAQVFQPCASLAASLAG-TPYQAAYAAGFGA----LAGARCASLQAKGLLAATTTAAQAEEALAKLRA-YGWEDEAQRLHPSLAAFEVAP 
 22 9burk-a0a0s9ndl4  58.1%  PGV----SIRRGA--TAVPVSARTLIDFTTYAHVFQTCAALAPSLAG-APYQAAYAAAFAT----VAPPRCASLKAKGLLTGTGTTAQAEEALAKLRA-YGWEAEAQVLHPSLAAFEVAP 
 23 9burk-a0a0u3d7f1  59.4%  LSV----SIQRGN--TTPLSFGKPLYDYITQANLLQNCASLASAAAG-SPGAVAFY-------ASFNAKRCQSLANKGIISGATTLDQANAALQKLRD-SGWEAESDLLHASHADYEVPE 
 24 9burk-h5wj03      59.5%  PGI----TVRRGG--VAQATVARPLIDFTSFANLYQPCAALSAQVAG-SPG-------SAFVVASVAAARCASLKAKGLLTADTLAAQADEALAQLAA-YGWEPEAAVLQASHAAFEIPS 
 25 rhoft-hboh        51.5%  ARL----SIVRGT--TTLVGTGKQLLDYFTLANLLQPCAALVSPSTN----------VFNTVNAAIAGNRCSALKANGLITGTTTAEQAASAMAALVA-AGWQPESSDLQASHYSFAT-L 
 26 polna-hboh        52.1%  ARL----SVKRGA--SVLVGTGKPLYDYFTLANLLQPCAALVSPATN----------AFNTVNAATATNRCSALKANGLVTGTTTAEQAASALAALVA-AGWQPESNVLQASHYSFAT-L 
 27 polsj-hboh        52.3%  TRL----SVRRGA--STLGGTGRSLFDYASLGNLLQPCAALASPTTN----------VFNTVNTTIATNRCNALQASGLIVGNTTAELAADAMARLLA-AGHQPESSVLQASHYSFAT-P 
 28 9burk-a0a1i7i9y5  51.5%  ARL----SVRRGN--SVLAGTGKPLYDYTTLANLLQPCAALASPATN----------VFNTINPMIAANRCAVLKANGMVNGNTTAEQAGSAMATLVQ-AGWQPEGNDLQASHYSFAT-L 
 29 9burk-j2kx41      51.7%  SRL----SMRRGN--VTLAGTGRPLYDYTTLANLLQPCAALLSPATN----------VFNTINPAIAANRCAVLKAQGLVNGDTTAEQAAGAMAVLQA-AGWQPESNDLQASHYSFAT-L 
 30 9burk-a0a1h3llv4  52.0%  SSL----SVIRGT--TIATGTGKPLYDYFTLANLLQPCAALASSAVN-APF-------LSSIVKATATNRCAALKTHGLISGNTTDELATSAMNALLA-AGWQPESRDLHAAMYAFAT-P 
 31 9burk-a0a0q8qlw9  52.2%  PAL----TIKRGN--TTVSRAGLGLYDTITIGNLYQPCAALSSSLTA-SPL-------LAAVSPTLAANRCAALKAKNLLTSTTLAAQADESLQKLRE-AGFESEADLLHASHFGTY--Q 
 32 9prot-a0a1p8fhr2  51.8%  SGV----TIKRGA--NTVAANSKVLYDYFTIANMLQPCAAMASSLAS-SPL------LSTNILAPNATNRCASLAAAGIITGTTLEERANSALNLLHA-SGWEADSDLFHASHYALAT-L 
 33 9burk-a0a0m2wss7  46.6%  SAY----TVRQGG--AVVANPGSALFDYATYAALYQPCVASVAGNAG----------------------RCTALVAKGLLDGADLAAQQADAKQRLRA-YGWLLDSDPLQAAHAGTNI-- 
 34 9burk-a0a255hvv2  47.0%  TAW----SVRQGA--VTVNGAGRALFDYATYAALYQPCIAAVAGNAG----------------------RCTALLAKGLLTGADLASQQQDAKRRLQA-YGWLPDADPLQAAHAGTNI-- 
 35 9burk-a0a1h8cn61  46.3%  ---------------------GKALFDYSTYAALYQPCIAATAAAPG----------------------RCTALVAKGLLSGGDLTAQQNDAKAKLKA-YGWLADSDVLQAAHAGTNI-- 
 36 9burk-a0a0x8gl12  48.4%  VGL----SILQGG--NLMPAIGSPLIDYFTLANLYQPCAVQSARLSG------ANSAFGTAVSPLLGSARCASLAAKGFLSGSTLEAQANEAYNKLIS-AGWLVESDALHASHYGLNATL 
 37 9neis-a0a2g3jcr7  48.2%  AGL----SILQGS--NKMPAIGLPLIDYFTLANLYQPCAVQSARLSG------ANSALGTAVSPQLGSARCASLAAKGFLNGSTLEAQASEAYNKLIA-AGWLAEADALHASHYGLNATL 
 38 9burk-a0a1k2h8v5  48.7%  SGI----SIQQGG--VLQTSIGKPLIDYFTLANLYQPCAVQAAALAG-------TNSAFNAVNATLGAARCSSLAAKGLVTGATLEEQASDALAKLRA-GGWLAEADALHASHYGLNATL 
 39 9burk-a0a0c1yp15  50.4%  DKL----VIKRGN--RVVTTHSKPLADYFTYASLFQPCAALAVPNSPGAAL----------LSAANSANRCTALAAKGLVSGSTTAERAADALDKLHA-YGWEAEQDALQASHYRLAT-P 
 40 rubgi-i0hxc6      49.4%  HGL----AIREGD--TPVATIGRPLADYFTFANLYQPCALLAPAAGGGTAV---ASAFWPAAFTASAQNRCTALAAKGLVAGATLAEQADDALARLHA-YGWTTDADFLHQSHYRFAT-N 
 41 lepcp-b1xzg8      46.9%  TTL----AIQQGTA-TPVATHSKPLIDYFTYANLYQPCAALSTSASS-GT--GVGAAFWPAAFTTSAQNRCAMLKAKGLIAGDTLAAQADDALAKLNQ-YGWQSEQNFFHQSHFRLAT-N 
 42 azosb-hboh        50.0%  DAV----RVVRGS--QVRTGTGRPLYDYTTFANLLQPCAVLSPRAAG-SPG-------EAFIPAALAANRCEALAAHEFITGNTPAERGDSALDALVA-YGWEPESTPLTASHYAFAV-P 
 43 9rhoo-h0pzw5      51.5%  NHL----VVRRGS--QIRTGSGRTLYDYTTYANLLQPCATLSPRAAG-SPG-------AAFVPAALATNRCEALVAHGLISGATPAEQGDSALDALLA-YGWEPESTPLAASHYAFAV-P 
 44 parxl-hboh        50.4%  AQV----SVAQGG--VPVGAFGKPLADYMTLANMLQPCAALAPAAAG-APY---LTALPGATTTSIRTARCASLAAAGVIAGADATTQATNALALLHQ-NGYQTDSDLLQAPMWDSQAVP 
 45 9burk-a0a248vv48  49.9%  AQV----SVAQGG--VPVGAFGKPLADYMTLANMLQPCAALAPAAAG-APY---LTALPLATTTAIRTARCTSLASAGVIAGANTTAQAINALALLHQ-NGYQTDSDVLQAPMWDSQAVP 
 46 9burk-a0a1m6k1z0  50.3%  ASV----SVTQGG--APVGAIGKPLADYTTLANTLQPCAALAPAATG-APY---LSALPLATTNAIRTARCASLASAGIITGGDVATQATNALALLHQ-NGYQADSDVLQAPMWDSQAVP 
 47 bursg-e1teq0      50.3%  SQV----SVLQGG--VPVGAFGKPLADYMTLANLLEPCAALAPAATG-SPY---LTTLPLATTTAIRTARCTTLAANGVIAGGDTATQATNALALLHQ-NGYQPDSDLLHAPMWDSQAVP 
 48 9burk-a0a1a9n382  49.8%  PLV----AVAQGG--VPVAAFGKPLADYTTLANMLQPCAALAPAAAG-APY---LSALPLATTNSIRTARCATMAAAGVITGGDVTTQAVNALALLHQ-YGYQTDSDLLQAPMWDSQAVP 
 49 9burk-a0a1n7rin1  50.8%  TQL----SVAQGG--VPVGAFGKPLADYTTLANMLQPCAALAPAAIG-APY---LSTLPVATTVQIRTARCAALAASGVIAGADVTTQATNALALLHQ-NGYQTDSDLLQAPMWDSQAVP 
 50 9burk-a0a0q5pi68  50.8%  SQV----SVRQGG--VPVASFGRPLADYMSLANLLQPCAALAPAAAG-APY---LTALPLVTTTAIRTARCASLASSGVISGGDVISQANSALTQLHQ-AGYQTDSDLLQAPMWDSQAVP 
 51 9burk-a0a158i436  50.2%  SQV----SVRQGG--VPVASFGRPLADYMSLANLLQPCAALAPAAAG-APY---LTALPLTTTTAIRTARCASLAVNGVISGGDVTSQANSALAQLHQ-AGYLTDSDLLQAAMWDSQAVP 
 52 9burk-a0a158f2z2  51.1%  SQV----SVRQGG--VQVASFGRPLADYMTLANLLQPCAALAPAAAG-APY---LTALPAATTASIRAARCASLAANGVITGGDVISQATNALAQLHQ-AGYQTDSDLLQAPMWDSQAVP 
 53 9burk-a0a069pj40  50.6%  PQV----SVRQGG--VPVGAFGKPLADYTTLANLLQPCAALATAANG-SPY---LSSLLLVTTNAIRTARCASLAASGLVSGGDPVSQGNDALSKLHE-AGYQTDSDTLQAPMWDSQAVP 
 54 9burk-a0a158fjp6  50.7%  SQV----SVRQGG--VSVGAFGSPLADYTTFANLMQPCAALAPAALG-APY---LTALPLATTLAIRTARCASLAASGLVSGGTTLEQASDALAKLHQ-AGYQSDSDTLQAPMWDSQAVP 
 55 9burk-a0a158i7p9  50.3%  SQV----SVRQGG--VPVGAFGSPLADYTTYANLLQPCAALATAAAG-APY---LSALPVATTNAIRTARCASLAVGGLISGGNTASQANDALSKLHQ-AGYQPDSDTLQAPMWDSQAVP 
 56 9burk-a0a158j083  49.8%  SQV----SVRQGG--VAVGAFGSPLADYTTLANLLQPCAALATAAAG-SPY---LTALPFATTNAIRTARCASLAASGLVAGGDTRSQANDALDKLHQ-AGYQSDSDTLQAPMWDSQAVP 
 57 9burk-a0a157ze58  50.8%  SQV----SVRQGG--VPVGSFGRPLVDYTTLANLLQPCAALAPAAAG-APY---LTTLAVSTTNAIRTARCATLATNGFVSGGNTVAQATDALNQLHQ-AGYQTDSDTLHAPMWDSQAVP 
 58 9burk-g8m711      49.8%  PQV----SVRQGG--VPVGSFGRPLADYTTLANLLQPCAALAPAAAG-APY---LTTLPVATTNAIRTARCATLAANGLVSGGNTVAQATDALNQLHQ-AGYQTDSDALQAPMWDSQAVP 
 59 9burk-a0a158bp80  50.8%  SQV----SVRQGG--VPVGSFGRPLADYMTLANLLQPCAALAPAAAG-APY---LTALLPATTNAIRTARCATLAANGLVSGGNTAAQATDALNQLHQ-AGYETDSDTLQAPMWDSQAVP 
 60 9burk-r4wsp2      50.6%  SQV----SVRQGG--VPVGAFGRPLADYTTLANLLQPCAALAPAAAG-APY---LTALPLATTNAIRTARCATLATNGLISGGNTVAQANDALNQLHQ-AGYESDSDTLHAPMWDSQAVP 
 61 9burk-a0a0a6qad6  49.5%  GNA----QVSEGG--QRIAAAGRPLADYMTLANLLQPCAALAQSAAG-APY---LTALPAATTAAIRQARCAALASAGYVHGSDTQTQANDALARLHD-AGYEADSDLLQAPMWDSQAVP 
 62 9burk-a0a1g7byt2  49.6%  ADA----QVKEGG--QRIAAAGKPLADYMTLANLLQPCAALADAAAG-APY---LTALPVAATTAIRQGRCASLAAAGDIRGSDTQAQANDALARLHA-AGYEADSDLLHAPMWDSQAVP 
 63 parp8-b2jvh3      48.6%  GHA----QVKEGG--QPIAAAGKPLADYMTLANLLQPCAALADAAAN-APY---LTALPVATTNAIRTARCASLAAAGYVHGSDVQTQANDALALLHQ-AGYEADSDVLQAPMWDSQAVP 
 64 9burk-a0a1q8iw17  47.0%  GSA----QVKEGG--QRIAAAGKPLADYMTLANLLEPCAALADAAAN-APY---LTALPLATTNAIREARCASLAAAGFVRGSDTQTQANDALARLHQ-AGYEADSDLLHAPMWDSQAVP 
 65 9burk-b5wc15      47.5%  GNA----EVIEGG--QRIAAAGKPLADYMTLANLLEPCAALADAAAG-APY---LTALPVATTGAIRQARCASLAAAGYVHGSDTQTQANDALAQLHQ-AGYEADSDLLQAPMWDSQAVP 
 66 parcy-a0a1x7gjk2  49.5%  RRA----EIVEGG--ERIAAAGKPLADYMTLANLLAPCAALAPDAAG-APY---LTALPVATTTAIRQARCTSLAAAGLIDGGDTPAQAADALARLHQ-AGYESDSDVLHAPMWDSQAVP 
 67 9burk-a0a1l6hzb8  50.5%  PNA----QVFEGG--LRIASAGAPLADYITYANLLQPCAAAAPALLG-APY---LSTLPLATTQAIRAARCASLAGSGFVNSGNLATQASDALNRLHS-AGYETDSDLLQASMWDSQAVP 
 68 9burk-a0a142ywf2  50.5%  SAA----KVFEGG--AQIPTAGAPLADYMTYANMLMPCAAAATAATG-APY---LTALPLATTQAIRTARCASLAAGGFVSGADAASQANDALAKLHA-AGYESDSDLLHAPMWDSQAVP 
 69 burvg-hboh        50.5%  PNA----VVRESG--RPVPSFGRPLADYATLANLLEPCAAASASLAG-EPY---LSALPLATTQSIRTQRCATLAAAGLVSGADTQSQAADALAQLHA-AGYLADSDLLQASMWDSQAIP 
 70 9burk-b1t7h7      50.2%  PNA----VVREGG--QPAPSFGRPLADYATLANLLQPCAAASASLAG-EPY---LSGLPAATTQSIRTQRCATLAAAGLVAGADTQSQAADALAQLHA-AGYLADSDLLQASMWDSQAIP 
 71 burm1-a0a0h3kh69  51.2%  PNA----VVRTGG--QPVTSFGRPLADYATLANLLQPCAAASASLAG-EPY---LSALPLATTQSIRTQRCATLAAAGLVSGADTQSQAADALAQLHA-AGYLADSDLLHASMWDSQAIP 
 72 9burk-u2gbn1      50.5%  PNA----VVRSGG--QPVPSFGRPLADYATLANLLQPCAAASASLAG-APY---LSALPAATTQSIRTQRCATLAAAGLVAGADTQSQAADALAQLHA-AGYLADSDLLQAPMWDSQAIP 
 73 burcj-b4ecv6      51.1%  PNV----VVRAGG--QAVPSFGRPLADYATLANLLEPCAAASASLAG-APY---LSALPAATTQSIRTQRCATLAAAGLVAGADTQSQAADALAQLHA-AGYLADSDLLQASMWDSQAIP 
 74 9burk-a0a119uvu7  50.3%  PNA----VVRQGG--APVPSFGRPLADYATFANLMQPCAAAASALAG-APY---LTALPSTVTQSIRAQRCATLAAAGLVAGADQQSQAADALAQLHA-AGYLADSDMLQAPMWDSQAIP 
 75 burps-hboh        49.8%  PGV----TVEQGG--APVPSFGRPLADYATLANLLQPCAAAAVAATG-APY---LSALPMGVTQSIRTQRCATLAAAGLVSGADTASQASDALAQLHA-AGYLADSDLLQAPMWDSQAMP 
 76 9burk-a0a0d5lcs9  50.0%  PGV----TVEQGG--ARVPSFGRPLADYATLANLLQPCAAAAIAATG-APY---LSALPVGVTQAIRTQRCATLAAAGLVSGADTATQASDALAQLHA-AGYLADSDLLQAPMWDSQAIP 
 77 9burk-a0a103ehy2  49.7%  PGA----MVEQNG--ASVPSFGRPLADYASLANLLQPCAAAAPAVAG-APY---LGTLPLAQTQAIRAQRCATLAAAGLVAGADTPSQASDALAQLHA-AGYLADSDLLHAPMWDSQAIP 
 78 9prot-a0a0n1b5s2  52.4%  AGL----QVQRGG--NNVAAFGRTLYDYTTLANLLQPCAAYAPANAA-SPF-------LAAINATIAQNRCAALAAAGVITGATFADQANVALAALRA-AGWEADSDLLHASHWATQATP 
 79 9burk-a0a059kik8  53.0%  AGI----AVRRGG--MAVSASGRPLYDYFTTASLYQPCAAIAASNAA-SPF--------NTVNATRAANRCASLKGAGLLSTTTTAEQAEEARQKLRD-AGWEAESDLLHASHWATNATA 
 80 marhv-hboh        41.3%  RSF----SIRQGNG-PALTEHSRSLLDYTTALAVYQGCANQAPGIRDLAPL------NGMFNPPATGQNICHSLFNKGLVSGATKDDWALDAQRILNEDFGVQPEQNLLAPVHFGLAVAQ 
 81 9alte-a0a1i6h326  43.4%  RSF----TIRQGSG-PVITEHSRSLLDYTTALAVYQGCANLAPAVRDTAPL------NAVFNSPAVGENICNSLANKGLIGGATLEDRATDALRILNEEIGIQPEQNLLAPVHFGLAVAQ 
 82 9alte-a0a2g1vdq6  41.9%  RSF----TIRQGDG-SVITEHSRSLLDYTTALAVYQGCANQAPAIAGLAPF------NLVAQD--IGQNICNSLANKGLVTGAEVADLATDALRILNEEFGIQPEQNLLAPAHFWLNVAQ 
 83 9alte-a0a0p8apl5  43.1%  TSF----TIRQGDG-PEIVEHSRSLLDYTTALAVYQGCANIAPEVRDEAPL------NAAFNDATVAGNICHSLANKGLISGATVDDQASDALRILEEDFGIQPEQNLLAPVHFGLAVAQ 
 84 9alte-a6f5e1      41.9%  TSF----TIRQGSG-PELAEHSRSLLDYTTALAVYQGCANIAPEVRDVAPL------NATFNNFTIAENICNSLANKGLVTGATTDDRASDALRILEQEVGIQPEQNLLAPVHFGLAVAQ 
 85 9alte-a0a072mx50  42.9%  DGF----TIQQGDG-VSITSHSRSLLDYTTALAVWQGCANQAPEIRDVAPL------NGVFNPPAVGENICSSLANKGLVTGATLDERASDALRILNEEFGIQPEQNLLAPVHFGLAVAQ 
 86 9alte-r8b0j8      41.3%  DSF----TIRQGNG-PVISGHSRSLLDYTTALAVYQGCANQAPAIRDVAPF------NSVFNPPAIGENICDSLASKGLVSGITTEERATDALRILNEDFGIQLEQNLLAPVHFGLSVAQ 
 87 9alte-n6wvv7      44.2%  TSF----TIRQGDG-PVITEHSRSLLDYTTAIAVYQGCANLAPGTRDSAPF------NDALNDFDVDENICTSLFNKGLVIGADVDAQAADAQRILEEEFGIQPEQNLVAPSHFGAAVAQ 
 88 9prot-a0a0d2sri5  44.6%  PSF----AIRQGGQ-PPFRSHSRSLYDTITLVNLYGPCAALAVPD---APL-----------DAGASAGRCEGLFRNGLLKSSGVQAQAAEAMEVING-YGILPEQNFLQPAYGSFSVPQ 
 89 9prot-w9h9a9      43.6%  PSF----AIRQGDG-PPVRDHSRPLLDYITLVNLYEPCAALSIAD---APL-----------NTAASAGRCEALARAGLLKASTTVAQAVEARAAINA-HGILPEQNFLQPAYNTFFVPQ 
 90 9chlr-a0a2h3l7f5  45.0%  RDL----RIEAGDELWALPNHSRGLLDYYTFLNIYAPCAVRDASLAT-APF--------NLVPAALGDARCASLATQGLVNGTTVEEQAADALTRIRA-YGMVEEQLVLLPSHHAFTVFE 
 91 causk-b0t3v3      39.4%  PAV----SVARGK--TVRQGVGRTLLDYFTYFNLYGPCAVLATPD---APW---------AGQVTRASERCGSLRLAGLLSAEAVPAQAAEALARLRD-YGFDPETDILHAASYMIGP-D 
 92 strhy-FKBW        12.7%  AALRDYPTYAAGG-------------------------------------------------------------------------PAAGQAREALLR-AGFPADSEFLWPYHHE----- 
 93 9actn-a0a0g3avt9  14.1%  QALRHYPAYAAGG-------------------------------------------------------------------------PGAADAAAALHR-AGFPPGSEFLWPYHYQ----- 
 94 9actn-a0a1d7ykt0  13.2%  QALRHYPTYAAGG-------------------------------------------------------------------------PGAADAEAALHR-AGFPAGSEFLWPYHHQ----- 
 95 9actn-a0a101p6p6  13.8%  PALREYPTYAAGG-------------------------------------------------------------------------AGAAEAAAALHR-AGFPAGSEFLWPYHYQ----- 
 96 strrc-v6jsq5      13.0%  TTLRDYPTYAAGG-------------------------------------------------------------------------AGAAQAQAGLHR-AGFPAGSEFLWPYHYQ----- 
 97 9actn-a0a0j8alc0  13.6%  AALRHYPAYAAGG-------------------------------------------------------------------------PGATEAEAALHR-AGFPAGSEFLWPYHHQ----- 
 98 strhj-h2jv72      14.1%  AALRHYPAYAAGG-------------------------------------------------------------------------PGAAEAQAALHR-AGFPAGSEFLWPYHHQ----- 
 99 9actn-a0a1q5kj90  14.1%  AALRHYPAYAAGG-------------------------------------------------------------------------PGAADARTALHR-AGFPAGSEFLWPYHYQ----- 
100 9actn-a0a1q5jti2  13.3%  SALRHYPAYAAGG-------------------------------------------------------------------------PGAERAREELHD-AGFPAGSEFLWPFHHQ----- 
101 9actn-a0a170yun5  12.8%  PALRHYPVHAAGG-------------------------------------------------------------------------RGAERARRELHR-AGFPAGSEFLWPYHHQ----- 
102 strvd-d5zzz8      13.5%  PALRHYPAYAAGG-------------------------------------------------------------------------PDADRARKELHR-AGFPAGSEFLWPFHHQ----- 
103 9actn-d9xmy1      12.8%  PTLRHYPAYAAGG-------------------------------------------------------------------------PDAEAARAAMHE-AGFPAGSEFLWPFHHQ----- 
104 9actn-a0a1v6msd3  13.9%  SALRHYPAYAAGG-------------------------------------------------------------------------PTAGQARARLHR-AGFPAGSEFLWPFHHQ----- 
105 9actn-a0a231pik6  14.5%  PALRHYPAYAAGG-------------------------------------------------------------------------AQADGARAALHA-AGFPAGSEFLWPYHHQ----- 
106 9actn-a0a243s7n5  14.0%  EALRSYPVYAAGG-------------------------------------------------------------------------EEAGEARQALHA-AGFPAGSEFLWPYHHK----- 
107 strvt-d9x4g9      13.6%  DALRNYPVYAAHG-------------------------------------------------------------------------EGADEARSALHA-AGFPAGSEFLWPYHHE----- 
108 strga-a0a089wz13  13.5%  QALRAYPRYAAGG-------------------------------------------------------------------------PDAERARAALHT-AGFPAGSEFLWPYHHQ----- 
109 stra4-a0a0b5em56  13.8%  PVLRHYPDYAAGG-------------------------------------------------------------------------PGAGRAREALYA-AGQPRGSEFLWPYHHQ----- 
110 9actn-a0a1b9f0r1  13.8%  PALRAYPRYAAGG-------------------------------------------------------------------------ADAEDAHRTMTA-AGYPAGSEFLWPYHHQ----- 
111 9actn-v6u5a7      13.4%  PALRAYPRYAAGG-------------------------------------------------------------------------ADAEEAHRTMTA-AGYPAGSEFLWPYHHQ----- 
112 strgg-b1vv39      13.8%  PALRAYPRYAAGG-------------------------------------------------------------------------ADAGAAHRTMTA-AGYPAGSEFLWPYHHQ----- 
113 strnv-v6jhg3      13.0%  PTLRAYPTYQAGG-------------------------------------------------------------------------AGAGAAHREIVK-AGFPAGSEFLWPYHHQ----- 
114 9actn-a0a1z1w3d1  15.0%  TALRAYPTYAAGG-------------------------------------------------------------------------AGAARAHRKILA-AGFPAGSEFLWPYHHR----- 
115 9actn-a0a0c1vxf7  14.1%  PALAAYPRYAAGG-------------------------------------------------------------------------PGADQARREMTA-AGFPAGSEFLWPFHHQ----- 
116 9actn-a0a1e7kkk9  14.4%  PALRYYPDYAAGG-------------------------------------------------------------------------PGADRAHGKMLA-AGYPAGSEFLWPFHHD----- 
117 9actn-a0a1d7vlb5  13.5%  PALRAYPAYAKGG-------------------------------------------------------------------------ADAGRAHAALLA-AGFPAGSEFLWPFHHQ----- 
118 9actn-a0a1c6lyy5  14.1%  PALRHYPAYAQGG-------------------------------------------------------------------------PGADEARRKMHE-AGFPRGTEFLWPYFYE----- 
119 9actn-a0a1c6nj41  14.4%  QALRHYPAYAAGG-------------------------------------------------------------------------PGADKARKALHG-AGFPRGSEFLWPYHHE----- 
120 9actn-a0a1e7jip1  13.6%  PALRHYPAYAAGG-------------------------------------------------------------------------PEGEKARKVMHK-AGFPKGSEFLWPYFHK----- 
121 9actn-a0a1e7kw84  14.4%  PALRHYPAYAAGG-------------------------------------------------------------------------PGADKARKALHR-AGFPKGSEFLWPYFYE----- 
122 9pseu-i0v4y5      13.9%  KALSAYPRYADGG-------------------------------------------------------------------------ADADAAHAELVA-AGFGEGSEFLWPYHYE----- 
123 9actn-v6knz8      12.5%  PALRAYPVYAAGG-------------------------------------------------------------------------EGAEAAHTRMTA-AGFPAGSEFLWPYHYA----- 
124 9pseu-a0a1h5qih7  14.1%  PALRAYPAYAAGS-------------------------------------------------------------------------P---AAHQSILD-AGFAPGSEFLWDYHYR----- 
125 9pseu-r1i3m0      14.3%  PALAAYPAYAAGS-------------------------------------------------------------------------P---SAHQSILD-AGFAPGSEFLWDYHYR----- 
126 9pseu-a0a1q9lh88  13.4%  PALRGY---------------------------------------------------------------------------------------QSGTV-TGFPEGSRFLWDYHHK----- 
127 9actn-a0a1n6wgk4  14.5%  PALRAY----AKG-------------------------------------------------------------------------DAA-----GVAA-AGFAPESDFLWPFHYQ----- 
128 9mico-a0a0a0jbp0  13.5%  AALKNYPAHAAG--------------------------------------------------------------------------DAA--AHDAIIA-AGFEPGSEFLWPFHHQ----- 
129 9mico-a0a0a0jwc4  13.5%  TALKHYPAYAATG-------------------------------------------------------------------------SPA--AHDAMIA-AGFEPGSEFLWPFHHT----- 
130 9mico-a3tg58      12.9%  TALKNYPAYAATA-------------------------------------------------------------------------SPE--AHAAMIG-AGFAPGSEFLWPFHNT----- 
131 9mico-a0a0q9lt59  15.3%  TALKNYPKYAATG-------------------------------------------------------------------------DQA--AHDAMIA-AGFAPGSEFLWAFHYS----- 
132 9mico-a0a0t2ikk7  13.4%  TALKNYPRYATTG-------------------------------------------------------------------------DPA--AHDAMIA-AGFAPGSEFLWPFHHA----- 
133 9actn-a0a239adt9  13.2%  QVLRAYPSYAATG-------------------------------------------------------------------------DPS--AHQALLD-AGLAPGSEFLWPFHDQ----- 
134 9actn-a0a1i5y3q1  13.5%  EALRNYPAYAATG-------------------------------------------------------------------------DPI--AHAAMLK-AGFAPGSEFLWDFNYR----- 
135 9actn-a0a239p629  14.0%  VALRNYPKYASTG-------------------------------------------------------------------------DPA--AHAAMLK-AGFAPGSEFLWDFNYS----- 
136 9actn-a0a0c5g9u7  13.7%  VAV----ARTLGS-----------------------------------------------------------------------------ARDEDLHA-VGFARGSEFLWPYHEK----- 
137 9actn-a0a086n6p2  13.5%  ATV----ARAFGA-----------------------------------------------------------------------------ARDEDLYA-AGFARGSEFLWPYHER----- 
138 9actn-a0a1q5luf4  12.8%  VAV----ARTYGR-----------------------------------------------------------------------------ATDEDMYA-AGFARGSEFLWPYHEK----- 
139 strto-a0a081xqk7  12.2%  VAV----ARSYGA-----------------------------------------------------------------------------ATDEDMYA-AGFARGSEFLWPYHER----- 
140 9actn-a0a124f0u4  13.0%  VTV----ARALGS-----------------------------------------------------------------------------ARDEDLYA-AGFARGSEFLWAYHEK----- 
141 9actn-a0a1e5p2p5  12.5%  VTV----ARSLGR-----------------------------------------------------------------------------AQDEDLLK-AGFAPGSRFLWPYHEK----- 
142 9actn-a0a1q5j3v0  13.0%  VTV----ARSLGQ-----------------------------------------------------------------------------ASDADMIG-AGFAPGSRFLWPYHEK----- 
143 9actn-a0a239d1v8  13.3%  VTV----ARAQGR-----------------------------------------------------------------------------AGDADLLA-AGFAPGSEFLWAYHQQ----- 
144 9actn-a0a0n1fwk5  11.6%  TAV----AYQAGR-----------------------------------------------------------------------------ATHADMLA-AGFAPGTEFLWPYHEA----- 
145 9actn-a0a1c5chu9  12.7%  TTV----AYAAGG-----------------------------------------------------------------------------AGADDMYE-AGFAPGSEFLWPYHQT----- 
146 strfr-a0a081en77  12.2%  TGV----AHSLGR-----------------------------------------------------------------------------ASDQDMLD-AGFTAGTEFLWPYHEQ----- 
147 9actn-a0a1g8xy87  12.5%  TAT----AYGMGR-----------------------------------------------------------------------------ASAEDLVV-AGFPAETDFLWPYHVR----- 
148 9actn-a0a0x3szz0  12.2%  TAV----AYGLGR-----------------------------------------------------------------------------ATEEDMLA-AGFAPGSEFLWPYHRL----- 
149 9actn-a0a1h3plu7  14.2%  TAV----RYSLGQ-----------------------------------------------------------------------------ATAADMYA-AGFARGSEPLWPYHQT----- 
150 9actn-a0a1i7c0f4  13.5%  TAV----RYTLGQ-----------------------------------------------------------------------------ADAEDMYA-AGFARGSESLWPYHQQ----- 
151 9actn-a0a239hpj8  13.1%  TAV----RYTLGR-----------------------------------------------------------------------------ADADDMYA-AGFARGSESLWPYHQQ----- 
152 9actn-a0a1i5tu93  13.4%  TAV----RYTLGQ-----------------------------------------------------------------------------ATAEDMYA-AGFARGSEPLWDYHRT----- 
153 9actn-a0a1m5evl2  14.3%  TAV----RYTLGQ-----------------------------------------------------------------------------ATAADMYA-AGFARGSEPLWEYHRT----- 
    consensus/100%           ...............................................................................................h....G...tt..h........... 
    consensus/90%            .th.....ht.Gt.............................................................................tu.t.hht.hGa..tsp.L.s.h.t..... 
    consensus/80%            ssl....thttGs...........................................................................u.tAhttlht.hGa.stSphL.s.hht..... 
    consensus/70%            ssl....shttGu.........................................................................stAtpAhttLtt.uGa.stS-hLhs.hht..... 

  1 ralso-hboh       100.0%  SVAVTFGNALARASVLDNLCNFSFAAVDS----A-FHPTAVN-ATS-LAQMAALGNGIPPTSGVQLINNLA-----Q-GGPTQSKQSVD-GSGALAANLDGALCLRNLLTGGDA------ 
  2 ralpj-b2uat7      82.9%  SVSTTFGNALSRASVTDNLCGLSFAATDA----S-FHPTAVN-ATA-LAQMAAVGNGIPPTSGVQLVNNNA-----Q-GGPTRSNQSVD-STGTQAANLDGALCLRNLLTGADA------ 
  3 cupnh-hboh        58.9%  AISVNYANAYAQASVTDRLCGYSFASTLT----D-LKPAAIA-PAA-LASMFATGNGVPPQPPVQLINDLD-----PQHGPYLNLASVSPSTLREDLNYDGANCLRSLLAGSDA------ 
  4 cuptr-b3r2m0      59.8%  AISVTYANAYARASVTDRLCGYSFAATLT----D-LKPAAIA-PAA-LASMYATGNGIPPQAPVQLINDRD-----PQHGPYLNLPSVSASTQRADLNYDGASCLRNLLTGSDA------ 
  5 cupnj-hboh        58.2%  SIAVTYANSYARASVTDRLCGYSFAATLA----D-FKPAAIA-PSV-LASMFATGNGVPPTSTVQLINDRD-----LQHGPFMNGQSVSASNNRADANFDGAKCLRDLLTGTDS------ 
  6 9burk-a0a0c4yad2  60.9%  AVSVTFANALARAGVADRLCGLSFAATGT----AVLTPAAIA-PAT-LNVLYATGNGVPPAAGVQLINDNN-----P-GGPLRDIYSQSPSNNVADANLDGARCLRGLLTGTGA------ 
  7 9burk-a0a069i4i2  59.1%  AVSVTFANALARAAVADRLCGYSFAATGT----AVLTPATIA-PAT-LNVLYSTGNGVPPAAGVQLINDNN-----P-GGPLRDLYSRSPGTSLADANLDGARCLRALLTGAGT------ 
  8 9burk-v2ivt7      59.4%  AVAVTYANALSRASVTDRLCGYSFSGINA----A-FEPAPVT-QAQ-MANMFATGNGVPPSSGVQLINDLD-----P-RGPRRDLLSRSPGSPVDDANTAGARCLRDLVTGISP------ 
  9 9burk-a0a1g6iei9  59.1%  AISATYANAYARASVTDKLCGYSYAAIGGG-----IVPLTIA-PAT-LNVMFSTGNGVPPGGGVTLINESA-----V-GGPTRDFVSITAGTNVQEANTPGALCLRDLLTGTSA------ 
 10 9burk-a0a1i1cz09  58.7%  SISVTYANSYSRASVTDKLCGYTFASPGA----ADNKPVTIP-PNT-LALTFSTGNGVPPSTGVTLMNESA-----Q-GGAIRDFVSIN-ADGTQDANLPGANCLRDLLTNSAA------ 
 11 9rals-a0a1h0kna3  57.2%  SISVTYANAYSRASVTDRLCNYSFAAVGT----A-LTPVAIP-AGS-LAGMFSTGNGIPPTAPVTLINDAN-----P-SGPLRDLVSQSPSTNLADGNLDGALCLRALLDNQNA------ 
 12 aciac-hboh        58.7%  SIAVTYANALSRASVQDRLCGYSFATTSA----I-GAVQPTP-AAV-TNTLFATGNGIPPTAGVQLVNDRS-----R-GVPVRDLFSSN-AAGVPTWNLEGALCLRSLVTGTDA------ 
 13 9burk-a0a1i1tgt8  58.2%  AIAVTYANALSRSSVKDNLCGYSFATTSS----I-GAVGPTP-STV-LADMFSTGNGIPPTAGVQIVNNRS-----R-GVPVRDVFSFN-TAGVPTWNLEGALCLRNLLTGTDA------ 
 14 9burk-a0a0q4rum3  57.4%  AVAVTFANSLSRASVKDHLCGFSYAGATA----A-GAVAPLA-PAA-LAGMFATGNGVPPSGGIQLINNQG-----R-LGAARDFLSVS-ESGVADWNTPGALCLRNLVTGTDA------ 
 15 9burk-a0a0q6zbr6  57.4%  AVAVTFANSLSRASVKDHLCGFSYAATAA----A-GAVTSLA-PAA-LAGMFATGNGVPPSGGINLVNNLG-----K-LGPARDFLSVS-DAGVADWNLSGAQCLRNLVTGNDA------ 
 16 9burk-k0i392      57.4%  AVAVTFANSLSRASVKDHLCGFSYAATAA----T-GAVTTLA-PAA-LAGMFATGNGVPPSGGINLVNNLG-----K-LGPARDFLSVS-DAGVADWNLSGALCLRNLVTGNDA------ 
 17 9burk-a0a165i0t6  58.2%  AVAVTFANGLSRASVQDNLCGFSYAATAA----T-GGVTPLA-AAA-LPGMFATGNGVPPSGGINLVNNLG-----K-LGPARDFLSVS-DAGVADWNLSGAQCLRNLVTGNDA------ 
 18 9burk-h0bzn8      57.0%  AVAVTFANSLSRASVKDNLCGFSYAATAA----T-GAVTPLA-AAA-LPGMFATGNGVPPSGGINLVNNLG-----K-FGPARDFLSFS-DAGVADWNTAGALCLRNLVTGTDA------ 
 19 9burk-j1eg31      59.3%  AVAVTFANSLSRASVQDHLCGFSYAGATT----A-GAVTPLAPPTA-LAGMFATGNGVPPAGGVQLINNRA-----K-QGPARDFLSVA-DGGSFDWNTEGAVCLRNLVTGSDA------ 
 20 comt2-d0j2k4      58.6%  AVSVTFANSLSRASVKDNLCGYSYTGATA----A-GAVTPLA-PEA-LVSMFSTGNGVPPSSGVQLINNKG-----K-FGAARDFLSVSVNSGVADWNTPGALCLRNLVTGNDG------ 
 21 9burk-a0a0q4y4j2  56.9%  AVAVTFASALTRAGVQERLCGYGYGATTA--LPL-AVPQALD-AVS-LATMFATGNGVPPASNVQLINDNS-----V-GGAARDIVSRSPSTGSYDLNLDGALCLRQLVDGSGA------ 
 22 9burk-a0a0s9ndl4  58.1%  AVAVTFANGLARAGVQERLCGYGYGATSA----L-GVPQALD-ATS-LAGMFATGNGVPPASNVQLLNENN-----P-GGAARDLLSRSPSTGAFDMNLDGALCLRDLVEGNGA------ 
 23 9burk-a0a0u3d7f1  59.4%  AVAATYANAYARASVKDKLCGYSFAATTA----A-GAPTVMG-AAA-LADMFAKGNGVPPSAGVNMINELS-----V-GGPVRNVFSVSPSSGTTDINADGAECLRKLLTGSDP------ 
 24 9burk-h5wj03      59.5%  AVSVTFANALSRASVADALCGYSFAATSA----A-FTPAAVG-AAA-LAGMAATGNGVPPSATVQLINNLN-----P-GFAFRDLVSFSPSTGKQDWNVDGALCLRQLVTGSDA------ 
 25 rhoft-hboh        51.5%  PVALTYANTYGRFGVADNLCGFSYAATGAATSATPLAPVPAS-AAV-LATSFGTSNGVPPTAGINIVNNNS-----V-GGPLLDAASLSVGG-VQDYNIAGALCLRGLVTGTSA------ 
 26 polna-hboh        52.1%  SVGLTYANTYGRFSVKDNLCGFSFAATGAAASATPNAPVPAS-ASA-LATSFGASNGVPPTIGINIVNNLS-----A-GGPLLDAASLSAGG-VQDYNIAGALCMRELATGSSA------ 
 27 polsj-hboh        52.3%  AVAVTFANSYGRFSVKDNLCGFSFAATGAAGSATPNAPVAAS-AAA-LATSFGASNGIPPTVGINIVNNNS-----V-GGPLLDAASLSAGS-VLDYNIAGALCLRELLGGSSA------ 
 28 9burk-a0a1i7i9y5  51.5%  PVALTYANAYGRAGVQDNLCGYSFAATAPAASPTPNLVVPAL-AGP-LATSFGTGNGVPPTAGINIVNNGS-----V-GGPMLDAASISPGN-VQDYNSPGALCLRALVTGTTP------ 
 29 9burk-j2kx41      51.7%  PVALTYANAYGRFGVQDNLCGYSFAATAPATSPTPNVPVPVS-AAA-LATSFGTGNGVPPTAGIAIVNNLS-----V-GGPLLDAASLSAGN-VQDYNSAGALCLRALVSGNSP------ 
 30 9burk-a0a1h3llv4  52.0%  SIAMTYSNAYGRFSVLDNLCGFSFSGATAG-----------------LASSFAKGNGVPPTVGISIFNNNS-----V-GGAVADAVSISPSTGVSDYNIDGALCQRELATGGSA------ 
 31 9burk-a0a0q8qlw9  52.2%  ILAPFYANMYGKFSVKDNLCGYSFAPVTAT-----GALTTLT-ATQ-EAQLFATANG-TPSGGLGLVNNNS-----V-GGPIADSFSVSPSTNVADYNIDGAICLRNLATGTDVTTGQPL 
 32 9prot-a0a1p8fhr2  51.8%  SVTYTYATAYSRSGVRDNLCGYSFGGAPT----A-GVPAALS-ANA-AAQLFGTGNGVPPTSGINILNNNS-----V-GGTALDAISVSPSTTVADYNFDGANCLRTLFTGTAA------ 
 33 9burk-a0a0m2wss7  46.6%  LVAVTYAYAYGKFSVTDKVCGFTFAQTDGS-----GNPIAFT-SAQ-KAASFAAQNGILG----NVVYENS-----V-GGAKVYTAGVSPSSSLADQSLDGFLCLRSLATGRDTVSGANL 
 34 9burk-a0a255hvv2  47.0%  LVAVTYAYAYGRFAATDKVCGFSFAQTDAL-----GNAVAYT-SAQ-KAASFATQNGILG----NVIYENA-----V-GGARLYTAAVSPSSNLPDQALDGFLCLRSLATGNDAVTGAAL 
 35 9burk-a0a1h8cn61  46.3%  LVAATYAYAYGKFSVTDKVCGFTFAPTDAG-----GVPVPFT-AAQ-KASSFATQNGIIG----SVVYEDS-----V-GGAKAYNFGVSPSSGLADQSLDAFLCLRALATGVDAVSGAAL 
 36 9burk-a0a0x8gl12  48.4%  GVALAYVNAYGRFSVKDNICGYSYAFTNTT-----GDVIAPI-GNN-LAGVFGSGNGVPPTSGISIVNNLS-----V-GGAKADAMSISASTNTADYNLDGAICLRKLATGLNPLTGATL 
 37 9neis-a0a2g3jcr7  48.2%  GVALTYVNAYGRFSVKDNICGYSYAFTNTT-----GDVIAPL-TNN-LAGIFGSGNGVPPTAGISIINNLS-----V-GGAKADAMSVSASTQSADYNLDGAICLRKLATGLNPLTGAAL 
 38 9burk-a0a1k2h8v5  48.7%  GVTMAYVNAYGRFSVADNVCGYSYAFTDA----TTGAVVAPL-ANN-LAAIFGNGNGVPPTGGISVVNNLS-----V-GGARADAFSLSASTNSADYNIDGAICLRKLATGIDPLTGAAL 
 39 9burk-a0a0c1yp15  50.4%  AIAMTYTNTYGRFSVTDNLCGFSFANTDA----S-GNVVAQN-PLV-QAALFSTGNGVPPTSGVNIVYNDA-----V-GGPRLDLLSVSPSTQLADFAFDGALCQRALVTGIDPVSGTAL 
 40 rubgi-i0hxc6      49.4%  SIATTYTNAYGRFGVEDRLCGFSFANTDA----A-GTPIAPS-ASA-VASIFSTGNGVPPTTGVNIVYDAS-----S-GGAKLDFLAVSPGTGLADFALDGALCQRSLVTGRDA-ADRLL 
 41 lepcp-b1xzg8      46.9%  AIVVTYINSYGRFSVTDNVCGYSMANTDA----A-GDVIAQA-PGT-QAGLFASGNGVPPTGGVNIVYNNSFLTSTT-SVAKLDFLAVSPSTTVADFALDGALCMRSLVTGLDPVNGAAL 
 42 azosb-hboh        50.0%  PIALTYANAYGRFGVEERVCNYSFAATDAA-----GTPIAWP-AAS-AATSFGTGNGIPPAAGLQIINDAS-----L-GGPRRDGASISPSTGKLDFNVDGALCLRQLWTGGGA------ 
 43 9rhoo-h0pzw5      51.5%  PIAVTYANTYGRFGVEERACNFSFAAVDSS-----GVPAPWL-PAL-AATSFGTGNGIPPASGLQIINDAS-----V-GGPRRDGASISPSTGKFDFNVDGALCLRSLWTDNSV------ 
 44 parxl-hboh        50.4%  AVAVTYADAYAKASVTANLCNFSFGTTNA-----AGTAGVTP-AVSPMLTVFGNGNGVPPTNGINLVFNSG-------AGAADHRLA------TADGSYAGASCLRTLWTNG-------- 
 45 9burk-a0a248vv48  49.9%  AVAVTYANAYAKASVTANLCAFSFGTTSA-----AGAAGVTP-AVSPMLTVFGNGNGVPPTNGINLVFNSG-------AGGADHRLA------SADASYAGASCLRTLWTNG-------- 
 46 9burk-a0a1m6k1z0  50.3%  AVAVTYANAYARSSVTDNLCNFSLGTTSS-----TGAAGVTP-AVSPMLTVFGNGNGVPPTNGVNLVFNAG-----A-TGAADHRLA------TADASYAGAACLRTLWTNG-------- 
 47 bursg-e1teq0      50.3%  AVAVTYANAYAKASVTDNLCNFSFGTTSS-----TGAAGVTP-AVSPMLTVFGNGNGVPPTNGINLVYNAG-----T-VGAFDHRLA------TVDASYVGAACLRTLWTNG-------- 
 48 9burk-a0a1a9n382  49.8%  AVAVTYANAYIKASVADNLCNFSFGTTNA-----AGTAGVTP-AVSPMLTVFGTGNGVPPTNGVNLVYNVG--------AGADHRLA------TADGSYAGAFCLRALWTNN-------- 
 49 9burk-a0a1n7rin1  50.8%  AVAVTYANAYARASVADNLCNFSFGTTSS-----TGAAGATP-AVSPMLTVFGNGNGVPPTNGINLVYNVG-----M-LGAADHRLA------TGDASFAGAVCLRALWTSG-------- 
 50 9burk-a0a0q5pi68  50.8%  AVAVTYANAYTQSSVTDNLCNFSFGTTNA----LTGAAGVTP-LVSPMPTVFGNGNGVPPTNGINLVYNAG-----N-PGAADHRFA------TTDASFTGAFCVRGLWTNGDA------ 
 51 9burk-a0a158i436  50.2%  AVAVTYANAYTQSSVTDNLCNFSFGTTNA----LTGAAGVTP-LVSPMPTVFGNGNGVPPTNGINLVYNAG-----N-SGAADHRLA------TADASFAGAFCVRGLWTNGDS------ 
 52 9burk-a0a158f2z2  51.1%  AVAVTYANAYTQSSVADNLCNFSFGTTNA----VTGAAGVSP-LVSPMLTVFGNGNGVPPTNGINLVYNAGNA--GN-SGAADHRFA------TADASFAGAFCLRGLWTNGDA------ 
 53 9burk-a0a069pj40  50.6%  AVAVTYANAYMQSSVADNLCNFSFGTTNA----VSGAAGVTP-LVSPMPTVFGNGNGVPPTNGVNLVYNAG-----N-AGAADHRLA------TADASFAGAACLRSLWTNGNA------ 
 54 9burk-a0a158fjp6  50.7%  AVAVTYANAYMQASVADNLCNFSFGTTNP----LTGAAGVTP-LVSPMPTVFGNGNGVPPTNGVNLVYNAG-----T-SGAADHRLA------TADASFAGAVCMRTLWTAGNP------ 
 55 9burk-a0a158i7p9  50.3%  AVAVTYANAYMQASVADNLCNFSFGTTNP----LTGAAGVTP-LVSPMPTVFGNGNGVPPTNGVNLVYNAG-----N-SGAADHRFA------TADASYAGAACLRTLWTTSNP------ 
 56 9burk-a0a158j083  49.8%  AVAVTYANAYMQASVADNLCNFSFGTTNP----LTGAAGLTP-LVSPMLTVFGNGNGVPPTNGVNLVYNAG-----T-SGAADHRLA------TADASFAGAVCMRTLWTTGNP------ 
 57 9burk-a0a157ze58  50.8%  AVAVTYVDAYMKASVLDNLCNFSFGTTNA----VTGAAGVTP-IVSPMPTIFGTGNGIPPTSGINLVYNAG-----T-TGAADHRFA------TPDASYAGAACMRALWTNGNP------ 
 58 9burk-g8m711      49.8%  AVAVTYVDAYMKASVLDNLCNFSFGTTNA----VTGAAGVAP-VVSPMPTIFGNGNGIPPTNGINLVYNAG-----T-AGAADHRFA------TPDASYLGAACLRGLWANGNA------ 
 59 9burk-a0a158bp80  50.8%  AVAVTYGDAYMKASVLDNLCNFSFGTTSA----ATGAAGVTP-VVSPMPTIFGTGNGVPPTNGINLVYNAG-----T-TGAADHRLA------TPDASYAGAACLRALWTNGNA------ 
 60 9burk-r4wsp2      50.6%  AVAVTYVDAYMQASVLDNLCNFSFGTTSA-----AGAAGVAP-IVSPMLTLFGNGNGVPPTNGINLVYSNG-----A-GGAADHRLA------TPDASYAGAACLRGLWTNGNP------ 
 61 9burk-a0a0a6qad6  49.5%  AVAVTYANAYTRSSVADNLCGFSFGTTSA----STGAAGVTP-AVSPMRTVFGLGNGVPPTNGVNLVYNVT-----P-AGGADHRLA------TPDASFAGAVCMRALWTNGDP------ 
 62 9burk-a0a1g7byt2  49.6%  AVAVTYADAYTRASVLDNLCGFSFGTTDP----STGAAGVAP-AVSPMPTVFGLGNGVPPTNGVNLVYNVT-----P-QNGADHRLA------TPDASFAGAACVRALWTNGDP------ 
 63 parp8-b2jvh3      48.6%  AVAVTYADAYTRSSVIDNLCGFSFGTTNA----STGAAGVAP-AVPPMPTVFGLGNGVPPTNGINLVYNGA-----S-QSGADHRLA------TSDASFKGAACLRALWTGNDP------ 
 64 9burk-a0a1q8iw17  47.0%  AVAVTYANAYMRASVVDNLCGFSFGTTNA----LTGAAGVAP-AV