9myco-a0a0d1kyf1

Mycolicibacterium llatzerense; Mycobacterium grossiae esterase found in n-term of an OsmC/Ohr family domain

Comment

"Other strains: Mycolicibacterium llatzerense\; Mycobacterium grossiae" || ". This esterase is found in n-term of an OsmC\/Ohr family domain excluded here"

Relationship

Family : Est-OsmC

Block : X

Position in NCBI Life Tree : Mycolicibacterium llatzerense

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSTPTRTVFRGSSGELVGKLEMPSDAPTAWALFAHCFTCG
KDNSAAGRIS RALASRGVAVLRFDFTGLGESDGDFAATG
FSSNVEDLVCAANYLRDQFSA PAVLIGHSLGGAAVLAAA
PQIPEVRGVVTIGAPADPFHVVGMLGDVTPVV ESGEATV
SIGGRPFRVRRQFLDDIAMQPQRERISTLDAALLVMHAPT
DQI VSVDNARIIFDLARHPKSFVALDGADHLLSDRADAE
YAANVLAAWASKYA

References

No reference