9myco-a0a100vw32

Mycobacterium brisbanense; Mycobacterium sp., Carboxylic ester hydrolase

Comment

"Other strains: Mycobacterium brisbanense\; Mycobacterium sp.852013-50091_SCH5140682"

Relationship

Family : Carb_B_Bacteria

Block : C

Position in NCBI Life Tree : Mycobacterium brisbanense

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSGSAEPAGDPSYVHVAQGTLRGNVAADHRLFAGIPYAAA
PVGPLRFAPP APAPGWAGVRDASVFGPRCVQDPTADPER
GRNTSEDCLSLNVWTPPASGE RRPVMVWIHGGAFVNGSS
GVYDARWLAARGDIVVVSINYRLGTLGFLAHP ALGPAGE
VGNYGMLDQQAALRWVHDNISAFGGDPDQVTIAGESAGGM
SVC NHLVAPGSAGLFRAAILMSAPCQAQADLATAQRRSL
DYAAAVGCPDPATA AACLRALPVDRLRKPVWYYNIGRDE
LTGPITGTKVLPVAPLAAFAAGKGS RVPVMVGTTRDEFT
LFVAMRYLQEGERFTADEYPRLLAETFGADAGKVAA QYP
PDRYGGVALAYSATVTDADFSCVADRMAATLSGPVYAYEF
NDRDAPA PDPFRTLPFPVGASHSLELRYLFDIGGAPPLN
PAQQTLSDTMIDDWSRFV SSGSPGWPAWDGASGSPRMSL
QSSGSHMADGFAQEHQCPFWAGLKGR

References

No reference