9rosa-w9qxl6

Morus notabilis. Putative carboxylesterase 2

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGSTKSAEVSIDAFPFLRLYKDGTIERLAGTQVTPPGLDP
QTGVVSKDVV VVPETGVSARLYRPDTENLDRNQKLPLAV
YFHGGGFFISSTADPVYHNGL NRLVAAARIAVVSVDYRL
APENPLPAAYDDCWAALRWLASDSAAAEPWLK DDVDLDR
VFLLGDSAGASIAHHMVCRLSGSDSDPSHGLKIAGIGLIH
PYF WGEDLVGLEAGDPVRRTMVDRWWKVVCPSEKGNDDP
LINPFAEGAPSLEG LKACGKILVLVAGEDILRDRGKLYY
EKVKESTWEGTIEIEETQGEDHIFH LLKPESEKAESLIK
RLAAFVKQG

References

No reference