9rosa-w9r853

Morus notabilis. Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Morus notabilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNMKKLLLVVVAILVVFGKWADGFVEYGLNETEMSLIESY
GVSNAIPNAL MVGLTLIYGANAKGAVCLDGTLPGYHWHR
GHGSGANNWLIQLEGGGWCNS VRNCVYRKTTRRGSSAYM
EKQIPFTGILSDKAEENPDFFNWNRIKLRYCD GASFTGD
SEHKAANLQFRGERIFWAGMEDLMSKGMRYAHQALLSGCS
AGG LAAILHCDDFRSLFPRTTKVKCLSDAGLFLDAPDVS
GGRTLRNMYTGVVG LQGVKKNLPRICTNHLDPTSNLINS
VRTPLFILNAAYDSWQIQSSLAPPS ADPHGYWHDCRLNH
AKCNPSQLLFLQGFRNQMLNVIRQFATSHQNGLFIN SCF
AHCQTERQDTWFADNSPVLHNKPIALAVGDWYFDRAAVKA
IDCPYPC DNTCHHLVFR

References

No reference