9rosi-v4tgh5

Citrus clementina; Citrus unshiu (Satsuma mandarin) (nobilis var.) Uncharacterized protein

Comment

"Other strains: Citrus clementina\; Citrus unshiu (Satsuma mandarin) (nobilis var.)"

Relationship

Family : Bodyguard

Block : X

Position in NCBI Life Tree : Citrus clementina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEPAMCKTKLVLSFTGSFLNKAVSFIVFSFLDLVDFLLCM
VYKVADFFIE AEWKPCYCSSAKEAITSSGKILVSEQGKS
KIVCLTSSKLHLEEISDTLYT RPSLVSEASKQTVNELKR
LKVDGNVAQSCERIKKGTVRSTFTVNSTIIEM LQGKIGG
QQSHPIPRWSDCDCKFCTCWSSSSRDTLFVKTQGPSDEAH
EDV LFIHGFISSSAFWTETLFPNFSSASKSTYRLFAIDL
LGFGRSPKPTDSLY TVREHLDMIEKSVIEPNKVKSFHIV
AHSLGCILALALAVKHPGSVKSLTL LAPPYYPVPKGAQA
SQYVMRKVAPRRVWPLIAFGASMACWYEHISRTICL LIC
KNHRVWEFLAKLVTRNRIRTFLLEGFFCHTHNAAWHTLHN
IICGTAN KLDGYLDAVRNHVKCDVNVFHGEDDELIPVEC
SYNVQRKIPRARVKVIEK KDHITIVVGRQKTFARELEEI
WRSSSGHEPSENHH

References

No reference