9sphn-a0a0q4irn1

Sphingomonas sp. Type IV secretion system protein VirJ

Comment

"Other strains: Sphingomonas sp. Leaf25"

Relationship

Family : VirJ

Block : X

Position in NCBI Life Tree : Sphingomonas sp. Leaf25

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MTRSPRQRRIARRRILGWSALAAGLLVLLALAAPALHLID
NRALRLFRGN GERNPKVVAVYLSGDMGLRFGLGAKVVPA
LAAHGIPVVGVSSPVTFGTRR SRAEADAIVANAIRTAMA
RTGATRVLLMGQSFGADIVSAIAPDLPADLRQ HIAAINV
VVPAQSVFFRSDPTGILYHGTPDAWPSAGMRRLDWAPVIC
IHG RDERESLCPTLAGTKAQVIGLPGGHFLRNDDKLVIA
TILAALRSADPTIL R

References

No reference