9sphn-a0a0q4u5t4

Sphingomonas sp. Leaf257. Uncharacterized protein

Comment

Relationship

Family : VirJ

Block : X

Position in NCBI Life Tree : Sphingomonas sp. Leaf257

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVELLARLRFRWRLMLGGALGLLAAIATILLYSGSYFDKD
PFTRFPAQGR VQPILVLSLSGDMGLRYGMGGVIARSLSA
DGIEVMGVNSPVLFRKRRTAA QVDEVIADLVRRAEAERG
ERKLVLLGQSYGSDMLQTGLAHLPADLRKAIS AVVLVVP
GETAFFRSDPSGLAYMGKPDSLGITTARQIDWVPMTCIYG
VRE PDSLCPMLEQPNVHVVALPGDHYLNHDEANLVAHVE
AAVRRAPSPAD

References

No reference