9sphn-a0a1t5gpc7

Sphingomonas histidinilytica. Carboxylic ester hydrolase

Comment

Relationship

Family : Carb_B_Bacteria

Block : C

Position in NCBI Life Tree : Sphingomonas histidinilytica

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MQRRDFLLASIAGLGWMHGSASAGRRTAEGASAAPVVRTS
EGLARGARAG GVATFKGLRYGAPVGGHARFSRAAPPQPW
PGVRDFRDFGDRAPQPGKHSP QIGLPAPDAGPWASFTDP
APAGEDCLRLNIWTPEADPGAARPVLVWLHGG GFREGSG
SINASDGQVLAAENGVVVVTVNHRLGVFGYLSLGHLDPAF
ADS GNVGMLDIVDALKWIRRNIRAFGGDPDRVAIFGESG
GGAKVCALMAMPEA RGLFHGAIAQSGVLVWGMERAQAAE
AANALLDTLGVGRDPQRLLDLPTQA ILDGVSALGDGWAR
KFLPVIGGSLPHHPFAEGVPAVSRDVPMIIGTSRDE ATI
LVGSPPIFALDWDGLRAALAKMFPGDMAALVAGYRRLYPA
KSPADVF FAVMSEFLIVRSSIYVANLRAAGASAPTWVYS
LEWPTPIMGGRFGVPHGL SVPLAFGTMARVPSMVPVDAG
STAVSALIRQSWSSFAAGGAPRPASIAWP PYGAAGREVL
AIDAVPSIVRDPRAAERHLLADLPWFDTNGDHRAAPPLAK
GMW

References

No reference