Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bace-b3cg11

Bacteroides intestinalis, Bacteroides cellulosilyticus, Putative uncharacterized protein

Comment
Other strains: Bacteroides intestinalis DSM 17393 Bacteroides cellulosilyticus DSM 14838


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Bacteroides intestinalis DSM 17393
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Bacteroidia: N E > Bacteroidales: N E > Bacteroidaceae: N E > Bacteroides: N E > Bacteroides intestinalis: N E > Bacteroides intestinalis DSM 17393: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ABJL02000008, ACCH01000224
2 UniProt : B3CG11, E2NFS6
2 UniProt : B3CG11, E2NFS6
2 Interpro : B3CG11, E2NFS6
2 Pfam : B3CG11, E2NFS6
2 PIRSF : B3CG11, E2NFS6
2 SUPERFAM : B3CG11, E2NFS6
Sequence
Graphical view for this peptide sequence: 9bace-b3cg11
Colored MSA for DPP4N_Peptidase_S9 (raw)
MSDGSPFQLCPHKAGRAFFCLTHQETLFIYIFSVFIPIFAPLKKPIRIMK
QISIAILLCLCTLASFAQDGQALDLKDIVSGKFRAENIYGVIPIPGDGEH
YSQMNPEGTQIIKYSFKTGKPVEVLFDAATARECTFKTFDSYSFSPDGTK
LLIATETTPIYRHSYTAVHYIYSLKRNINGEINNIVEKLSDGGPQQVPVF
SPDGTMVAFVRDNNIYLVKFLYGNSESQVTEDGKRNAILNGIPDWVYEEE
FSFNRALEFSADNKMIAYIRFDETEVPSYSFPVFAGSNPHITAFEKYPGD
YTYKYPKTGEANSKVSVHTFDIKSKVTRKMQVPMDADGYIPRIRFTHDPN
KLAIITLNRHQNRLDMYFGDPRSTVCKQVLRDESDAYIKEAVFDNIIFYP
ENFSFVSEKSGYNHLYWYSMGGNLLKQVTAGNYEVKDFLGWDADDNSFYF
TSNEESPLRKAVYKIDRKGKKTKLSTQPGINTAQFSTNMKYYMNRYSNLS
TPTVITLNDNAGKVLSTLVTNDNLKKTLTQYNVPQKEFFTFQTQDGVTLN
GWMMKPTDFSASKKYPVLLYQYSGPGSQQVLDTWSISWETYMASRGFIVV
CVDGRGTGGRGADFEKCTYLNLGVKEAKDQVATAQYMGSQSYVDKSRIGI
WGWSYGGYMTIMSMSEGTPVFKAGVAVAAVTDWNYYDTIYGERFMRTPKE
NAEGYKSSSAFTRANQLNGNLLLVHGMADDNVHFQNCAEYAEHLVQLNKQ
FDMQVYTNRNHGIYGGNTRYHLYTKLTNFFERELK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDGSPFQLCPHKAGRAFFCLTHQETLFIYIFSVFIPIFAPLKKPIRIMK
QISIAILLCLCTLASFAQDGQALDLKDIVSGKFRAENIYGVIPIPGDGEH
YSQMNPEGTQIIKYSFKTGKPVEVLFDAATARECTFKTFDSYSFSPDGTK
LLIATETTPIYRHSYTAVHYIYSLKRNINGEINNIVEKLSDGGPQQVPVF
SPDGTMVAFVRDNNIYLVKFLYGNSESQVTEDGKRNAILNGIPDWVYEEE
FSFNRALEFSADNKMIAYIRFDETEVPSYSFPVFAGSNPHITAFEKYPGD
YTYKYPKTGEANSKVSVHTFDIKSKVTRKMQVPMDADGYIPRIRFTHDPN
KLAIITLNRHQNRLDMYFGDPRSTVCKQVLRDESDAYIKEAVFDNIIFYP
ENFSFVSEKSGYNHLYWYSMGGNLLKQVTAGNYEVKDFLGWDADDNSFYF
TSNEESPLRKAVYKIDRKGKKTKLSTQPGINTAQFSTNMKYYMNRYSNLS
TPTVITLNDNAGKVLSTLVTNDNLKKTLTQYNVPQKEFFTFQTQDGVTLN
GWMMKPTDFSASKKYPVLLYQYSGPGSQQVLDTWSISWETYMASRGFIVV
CVDGRGTGGRGADFEKCTYLNLGVKEAKDQVATAQYMGSQSYVDKSRIGI
WGWSYGGYMTIMSMSEGTPVFKAGVAVAAVTDWNYYDTIYGERFMRTPKE
NAEGYKSSSAFTRANQLNGNLLLVHGMADDNVHFQNCAEYAEHLVQLNKQ
FDMQVYTNRNHGIYGGNTRYHLYTKLTNFFERELK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer