Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9gamm-a3yc27

Marinomonas sp. MED121. Uncharacterized protein

Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Marinomonas sp. MED121
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Oceanospirillaceae: N E > Marinomonas: N E > Marinomonas sp. MED121: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AANE01000007, WP_009832915
1 UniProt : A3YC27
1 UniProt : A3YC27
1 Interpro : A3YC27
1 Pfam : A3YC27
1 PIRSF : A3YC27
1 SUPERFAM : A3YC27
Sequence
Graphical view for this peptide sequence: 9gamm-a3yc27
Colored MSA for Chlorophyllase (raw)
MNNLIDIAQHLPVSKAEQTISISPVLIESSRRPHPLELRITAPVKGENLP
VVLFSHGDGPSLYLPSKDGYGPLVNFYAEHGFVVIQPTHANSKVAGFDSN
KSDAPLFWRERVNEMKLILDELENIESGIPALKGRINHQNIAAVGHSMGG
QTVGMLLGAHLTDSRRIKDRDVSTFEPRIKVGVLLAAPGKGGDSLSEFAR
TNFTELNPDFRYLKTQALSVVGDADNNTFMSIKGPEWYTDPFKEAPGIDL
LLTLHGAKHGLGGIAGYDAKETSDESPDTLAATQRLTWAYLKSAFDSNDF
TWEKARNQLAGPARSLGHITDK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNNLIDIAQHLPVSKAEQTISISPVLIESSRRPHPLELRITAPVKGENLP
VVLFSHGDGPSLYLPSKDGYGPLVNFYAEHGFVVIQPTHANSKVAGFDSN
KSDAPLFWRERVNEMKLILDELENIESGIPALKGRINHQNIAAVGHSMGG
QTVGMLLGAHLTDSRRIKDRDVSTFEPRIKVGVLLAAPGKGGDSLSEFAR
TNFTELNPDFRYLKTQALSVVGDADNNTFMSIKGPEWYTDPFKEAPGIDL
LLTLHGAKHGLGGIAGYDAKETSDESPDTLAATQRLTWAYLKSAFDSNDF
TWEKARNQLAGPARSLGHITDK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer