araal-a0a087g976

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRTLFLLGFLVAGLILGTEANEFLEFNVTDLDRIEELEFG
FSKFSSNYNP LMVGLTLIRGAGTKGAVCLDGTLPGYHLH
RGHGSGAYSWLIQLEGGGWCD NIRNCVYRKKTRRGSSNY
MEKQIQFTGILSNKAQENPDFFNWNRVKLRYC DGGSFSG
DSQNKAARLQFRGERIWRAAMDDLKSKGMRNAKQALLSGC
SAG GLAVILRCDEFSNLFSRSTKVKCLSDAGLFLDTPDV
SGGHTIRNLYNGVV QLQGVRNNLPHLCTNHLNPTSCFFP
QNLISQMKTPLFIVNAAYDIWQIQS SIAPPRADPSGYWH
ECRLNHGRCTPAQIRFLQGFRDQMLRVVSEFSNSRK NGL
FINSCFAHCQTERQDTWFADDSPVIHKKAVAIAVGDWYFD
RAEVKLI DCPYPCDRSCHNLVFR

References

No reference