araal-a0a087gcs4

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKTSRLLHFTAAMVLLVLVALSPPLVSGDPARRVKMTLVR
DAAALGAFCL DGSLPAYHLDRGFGSGSNNWLLQFEGGGW
CNDIASCVDRSKTRRGSTRFM SKTVVFSGILSNNASLNP
DFYNWNKVRLRYCDGASFAGDTQIGNGTSLLY FRGQRIW
NAIILDLLPKGLAKARKALLTGCSAGGLSTFLHCDNFTSY
LPK TANVKCMSDAGFFLDAIDVASNRTMRTLYTQLVSLQ
GVEKHLDPNCTQAF YPEPSLCFFPQYVLRFIKTPFFILN
SAYDVFQFGHGLVPPSADRTGRWRR CKLNVTACNPHQLD
ALQGFRTDMLGTLMNFFRNSTRGGMFINSCFDHCQS ALQ
ETWFSPTSPRIHNKTIAETVGDWYFEREKEVKEIDCPYPC
DKTCHNL ISAPTDSL

References

No reference