araal-a0a087gsy4

Arabis alpina (Alpine rock-cress) Uncharacterized protein

Comment

Relationship

Family : Bodyguard

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MAIARWLNRTVGFLVFFFLDILDFLLCYTYKTIDYFYESE
WRPCYCSSPP EAQAKTEKIIVSERGEYSKVVSMTRTKIH
FDEISDTLYSRGPSLLMRLSK LVRSVKCFNYKGLIMRRN
AVESCDHHHHDHESKSKKKICKKRLMTLNSTV VEKSPTT
PRWSDCHCSFCTSWLSSSNKDSLFVRVQQPKDNKKARENV
VFI HGFLSSSAFWTESLFPNFSDSAKSNYRLIAVDLLGY
GKSPKPNDSLYTLR EHLEMIEKSVISRFKLKTFHIVAHS
LGCVLALALAVKHPGAIKSLTLLAP PYYKVPKGVQAAQY
VMKKVAPKNVWPPMQFGASLISLYEHLGRTVCLVLC KNH
HLLETVTRLLTLNRMRTYLIEGFLCHTHNGSWHTLHNIIF
GAGAKLE SYLDHVRDHVHCDVTIFHGGKDEVIPVECSYS
VQTKVPRATVHVIPDKDH ITIVVGRQKEFARELELIWQR
SSKTNCIIK

References

No reference