araal-a0a087gzt8

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRSLLLLCIAVVLWSLAAVVVRSGSSDGFRDTEAEISLLE
KKLITSEVLM VPLTLIQGADSKGAVCLDGTLPGYHLDRG
FGSGVNSWLIQLEGGGWCYNH RSCVYRKTSRRGSSNFME
KALAFTGILSNKPQENLDFFNWNRVKLRYCDG ASFAGDS
QDEASQLFYRGQRIWQVAIETFLSLGMQQANQALLSGCSA
GGL ASILHCDEFRELLPSSTKVKCLSDAGMFLDAVDVSG
GHSIRNMFQGVVTL QNLQKDLSSTCTNHLDPTSCFFPQN
LVSDIKTPMFLLNTAYDSWQIQQSL APPTADPGGIWNAC
KADHSHCNSSQIQFLQEFRNQMVLSLNSFSSSNQNG LFI
NSCFAHCQSERQDTWFAQDSPQLYGKRVAESVGDWYFDRV
NTVKNID CPYPCDTTCHNLIFE

References

No reference