araal-a0a087h5q1

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MLQIPVTVFRLLLFFFSVVRSGSSDGFRDTFDTISLLENQ
TMVKPPLQLL MVPLTLIQKAASKGAVCLDGTLPGYHLHR
GFGSGANRWLIQLEGGGWCNT RRNCVFRKTTRRGSSKFM
EKVLAFTGILSNKANENPDFFNWNRVKLRYCD GASFTGD
SQDESSQLYYRGQRIWQAAMEEFLSIGMHKAEQALLSGCS
AGG LASILHCDQFKELLPRTTKVKCLSDAGMFMDAVDVA
GGHSLRNMFKGVVT IQNLQKELSTTCTKHLDPTSCFFPQ
NLVSNIKTPMFLLNAAYDAWQVQES LVPPSVDISGSWKA
CTSDHSHCNASQIQFFQDFRTQMVNAVKSFSASTHN GVF
LNSCFAHCQSERQDTWYAPDSPKLHGKTVAESVGDWYFDR
TTVKAID CPYPCDKTCHNLIFK

References

No reference