araal-a0a087h875

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAIPKFSSLFRCRKWAKSDWLAAFLGFVLVVFFLSFFFDS
PFDSDSVSSV DQSLPITYPPNLVKLKLSSLAKERGAFCL
DGSLPGYHFQNGSGSGSNSWL LHLEGGGWCSTIASCSSR
AMTNYGSSNYFEDEVSFPGVLSNDPSQNPEFF NWNRVVI
RYCDGASFAGRPEAEFKNETRLFFRGQLIWETIMDELLSM
GMS DAKQAILTGCSAGGLAALIHCDYFRDHLPKDAVVKC
FSDGGFFLNLPDVL GNPTMENFFNDVVNLQGVDKSLDQS
CVAKMDPCKCMFPHEFLKNIRTPVF LVNAAYDSWQIEHV
LVPVSADPDKSWAKCRLNIKECDAEQMKVLHGFRSS LMD
GIGEFHQNKVGGMFIDSCFSHCQSVAPETWHSPTSTRIEN
KTIAESV GDWFFNRNPVKLIDCPYPCNPSCSNMNFA

References

No reference