araal-a0a087h876

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Pectinacetylesterase-Notum

Block : X

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAIQRFSSLFRCRKWAKGDWLVASLGFVLIVFLLSFFFDS
PLDSDTVSSV DRSLPIAYPPDLVKLKLSSKAKEKGAFCL
DGSLPGYHFRNGSGSGSKSWL LHLEGGGWCNSIASCSSR
AMTKLGSSNYFEHEVAFQGVLSNDPSQNPEFY NWNRVKI
RYCDGASFAGRPEAEFKNETRLFFRGQLIWEAIIDELLSM
GMS DAKQAILTGCSAGGLATLIHCDYFRDHLPKKATVKC
VSDGGYFLNVPDVL GNPTMRSFYHDVVSLQGVDKSLDQK
SVTKTDLSKRMFPHEFLKNIRTSVF LVNAAYDFWQIEHV
LVPASADPDKTWAKCRLNIKECDVAQMKVLHGFRSS LMD
GIGEFHQNKVGGMFIDSCFSHCQTSMSVTWHSPTSPRIEN
KTIAESV GDWFFNRKPVKLIDCAYPCNPSCYNMNFT

References

No reference