ascsu-f1kzr3

Ascaris suum (Pig roundworm) (Ascaris lumbricoides) esterase

Comment

Relationship

Family : Carb_B_Nematoda

Block : C

Position in NCBI Life Tree : Ascaris suum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRRWIDSIFIFTLQILAISQISPDDDFTLRILSGGKIRGR
QVITEQNVSG YQFLGIPYAEPPIANLRYRKPIPIKKWEN
VIDTTEYKQSCLWNSSETSND PNRTPMSEDCLFINVLTN
RKCLIEGGCAVIFYIHGGGYRYDTPSLFSPQF LIDNFLT
EERSVVFVMPAYRLGSFGFLNLSPNFSTSAIKNIAFHDLL
EAL RWVQKEIKHFGGDANRVTIMGHSSGGDTANLLTMSP
MAKNLFSKAIAMSA GGTTPLPFDKNQEASVRLARAARCA
NNSTNFDDRHQAEAVLRCLRATDAQ QLIVLQRGLEDEGY
PFEGPCIDGPGGVLPEGIPKLRQKRYPIRLLIGSTA EEF
SDTAFLVQPNGKVDTHRLLSVCREAVAEMAFRNTWQTTAD
CFIEYLN PSRAPHVFDDTSIFLSTALSSEDIHNAGGVSF
LYEFQYRFVDGAFNFSRV SLPGERPQHTEDLVYIMGIHK
GNFTTKDETIRRMYSEIFVSFVKTGHPSI DGEPSWMPFT
PTRNNYFVVDFDENNHMPGMRDRYHERVLKLWNGKALRHS
GGILDPVSEKETLHFDVDDDGALANFAAWTDPHSFNRLK
GFRVGDVETLQ DVLTDAPMDGSTDGVVTAASLIDGGKWN
FYFWIAIIIVVVLVILLLITCA LLCYNREKRREYERII

References

No reference