baciu-a0a0d5d3y1

Bacillus subtilis. Uncharacterized protein

Comment

"previously 5_AlphaBeta_hydrolase"

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Bacillus subtilis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MHFSKMIDRLALYDLHRKRSKDKHFSAVFTADIDDREEFY
SANTADVSID LNESKKNYRVGTFSYESLIQTGNLVNDTL
KGEVFLNENEIDQPNVIFVHG WRMDSYNRIKKIFHNRIM
NDLGWNMYYYSLPYHFEREPENSLYSGELMIS ANIDRTI
ESTRQAVVDLRALIYWIKANKKGPVIIVGVSLGGWVTNLI
ATL DSQIDVMVSIFYANRLSYSIWNTIPGKFIREELEQN
GVTYEDLTKYWNIT DPSQALPKVNKDNILLISAKHDQYI
DLKDADYLWESWEKPKRYVYNCGHS GIVLCRKKLANDTI
SFIRERIHTGKPGSVHL

References

No reference