brarp-m4c940

Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) (Field mustard) Brassica campestris Uncharacterized protein

Comment

"Other strains: Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) (Field mustard)\; Brassica campestris"

Relationship

Family : Bodyguard

Block : X

Position in NCBI Life Tree : Brassica rapa subsp. pekinensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MGAMRTRSASVGRWVNEVVSFVVFCLLDIFDYLLCLLYKT
ADYLLEAEWK PCYCLSPKKLITTSRGNILLSHNNCESKI
LTVSPLQQLSGRSKIELEEIS ETLYSRPSLLSDHLSKLS
IIDLTKWVVNMTRSHSDCGEIKTSKKRRKTLK SSFTVVE
MLQGKIRPQNLSQQISRWSDCDCGFCTCWNSTCVKDQSLF
VKT QFPNGNIENEDVLFIHGFISSSAFWTETVFPRLSKS
KYRLFAVDLLGFGK SPKPADSLYTMREHVEMIEKSVLLK
HNVKSFHIVAHSLGCILALGLVAKH GGSIKSLTLLAPPY
HPVPTTEAEPRQYVMKKVAPRRIWPPIAFGASMACW YEH
ISRTICLLICKNHRLWQFLAKLITRNNRTVNFLIEGFMCH
THNAAWH TLHNIICGVGSKLDSYLDIVRDKLKCNVTIFH
GRDDEVVPVECSYNVQSR IPRARVKVVENKDHITLVVGR
QVEFAKELEEIWKSSSC

References

No reference