cicar-q6kaw1

Cicer arietinum (Chickpea) (Garbanzo) putative esterase

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Cicer arietinum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSNKIWPPPPSNNPYEYLKIHHNPNDTLTRNLVDPHTSPS
SNTTLPINVL TKDLTINQSHQTWLRLFLPKNSTNPNQNN
KLPLIIFFHGGGFILLSAAST IFHDFCVELADTVEAVVA
SVEYRLAPEHRLPAAYDDAMEALTFIKSSEDE WLQNYVD
FSTCYLMGNSAGATIAYNAGPMCNLKKVNDFEPLKIQGLI
LSQ PFFGGTQRSESELRLENDPVLPLSVGDLMWELALPI
GVDRDHKYGNLTAE NDLDEKFDKIKDQGWRVLVSGNGGD
PLVDRYKELVELMEKKGVEIVKDFE EEGFHGIEFFEPSK
AKKLIGLVKGFISSFVV

References

No reference