cocap-a0a1r3ha34

Corchorus capsularis (Jute). protein bem46-like

Comment

Relationship

Family : ABHD13-BEM46

Block : X

Position in NCBI Life Tree : Corchorus capsularis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVSYVSLLLYGVGGIVVAGMALLVAFQEKLVYVPVLPGLT
KSYPITPARL RLVYEDVWLRSSDGVKLHAWFIKLFPDCR
GPTILFFQENAGNIAHRLEMV RIMLQRLQCNVFMLSYRG
YGASEGFPSQHGIINDAQAALDHLSQRTDIDT DRIVVFG
RSLGGAVGSVLTKNNPDKVAALILENTFTSILDMAGVLLP
FLK WFIGGPGTKGPKILNFLVRSPWSTIDIIGEVKQPVL
FLSGLQDEMVPPSH MQMLYAKAAAHNRQCQFVEFPNGMH
MDTWLSGGDHYWTTILEFFEQHVPE KKQNGPSQNGYGGF
DLTPFTAPCAATPSLLWRSLVGCQLEAWNQAHEVLM NF

References

No reference