cocap-a0a1r3ibd6

Corchorus capsularis (Jute); Corchorus olitorius Alpha/beta hydrolase-1

Comment

"Other strains: Corchorus capsularis\; Corchorus olitorius"

Relationship

Family : Bodyguard

Block : X

Position in NCBI Life Tree : Corchorus capsularis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

No Genbank

Sequence

Peptide

MGVMCKIRSVLTLVGDVLNKAVSFIVFCFLDLLDFILCFV
YKVADFFIEA EWKPCYCSSAKEAITGSGKILVSEQGESK
VVCLTSSKLQLEDISDTLYSR PSLVTEVSKLTVTELKKL
KLDGTIIQSCEKVKKGTVRSTFTINSTIVEML QGKMVGQ
QLHPIPRWSDCDCKFCNSWTSSSKDTLFVKAQGPKDKARE
DVL FIHGFISSSAFWSETLFPNFSTSAKSTYRLLAVDLL
GFGRSPKPTDSLYT LREHVDMIEKSVLDAYKVKSFHIVA
HSLGCILALAIAVKHPGSVKSLTLL APPYFPVPKGEPAT
QYVMRKLAPRRVWPVMAFCSSIACWYEHISRTVCLL ICK
NHRLWEFLTKLVTRNRIRTFLLEGFFCHTHNAAWHTLHNI
ICGTASK LDSYLDAVRDRLKCDVTIFHGKDDEVIPLECS
YDVQRRIPRARVKVVENK DHITIVVGRQKAFARELEEIW
KGSPKD

References

No reference