cocap-a0a1r3kav9

Corchorus capsularis (Jute); Corchorus olitorius. Alpha/beta hydrolase-3

Comment

"Other strains Corchorus capsularis (Jute)\; Corchorus olitorius"

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Corchorus capsularis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVQEKKIVDEVSGWLTVYDDGSVDRAWTGPPEVKFMTEPV
PPHENFVEGV ATRDVTIDSNSGLKVRIYLPEQIPTTNTK
LPIILHFHGGGFCISQADWFM YYSIYTRLARSVPAICVS
VYLRLAPENKLPAACDDGYAALLWLRSLAKGE SQSHEPW
LNEHADFNRVFLIGDSSGGNIVHQVAARAGEVDLGPLRLA
GGI PVHPGFVRAEQSKSELEQPESPFLTLDMADKFLALA
LPLGSTKNHPITCP MGSTAPPIDGLDLPPILFCVAEKDL
LKDTEMEYYEAMKKANKDVELFISH GMSHSFYLNKIAVE
MDPNTAAQTTALFEGIKEFINKH

References

No reference